Basic Vector Information
- Vector Name:
- pMRKO1
- Length:
- 5881 bp
- Type:
- Suicide vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Ramsey M, Rumbaugh K, Whiteley M.
- Promoter:
- lac
pMRKO1 vector Map
pMRKO1 vector Sequence
LOCUS 40924_32310 5881 bp DNA circular SYN 18-DEC-2018 DEFINITION Suicide vector pMRKO1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5881) AUTHORS Ramsey M, Rumbaugh K, Whiteley M. TITLE Aggregatibacter actinomycetemcomitans suicide vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 5881) AUTHORS Ramsey M, Rumbaugh K, Whiteley M. TITLE Direct Submission JOURNAL Submitted (09-AUG-2010) Molecular Genetics and Microbiology, University of Texas at Austin, 2506 Speedway Blvd, Austin, TX 78712, USA REFERENCE 3 (bases 1 to 5881) TITLE Direct Submission REFERENCE 4 (bases 1 to 5881) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-AUG-2010) Molecular Genetics and Microbiology, University of Texas at Austin, 2506 Speedway Blvd, Austin, TX 78712, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5881 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 171..759 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 1047..1068 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1083..1113 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1121..1137 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1145..1161 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1229..1936 /codon_start=1 /label=mCherry /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)" /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA EGRHSTGGMDELYK" CDS 2310..2984 /codon_start=1 /gene="SpcR" /product="spectinomycin resistance protein" /label=SpcR /protein_id="ADV78249.1" /translation="MFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLY QAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILT MDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLK KL" gene 2310..2984 /gene="SpcR" /label=SpcR rep_origin complement(3169..3525) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" oriT 4169..4278 /label=oriT /note="incP origin of transfer" CDS 4311..4679 /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" promoter complement(5750..5854) /label=AmpR promoter
This page is informational only.