pMRE107_PnptII_mTq2 vector (V004474)

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V004474 pMRE107_PnptII_mTq2 In stock, 1 week for quality controls

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

pSC101 ori is a low-copy replication origin that requires the Rep101 protein, which is a temperature-sensitive protein. When bacteria containing a plasmid with this ori is cultured at 37℃, the plasmid will be lost.

Vector Name:
pMRE107_PnptII_mTq2
Antibiotic Resistance:
Ampicillin
Length:
13617 bp
Type:
Tn7 delivery vector
Replication origin:
pSC101 ori
Source/Author:
Remus-Emsermann MNP., Gisler P, Drissner D.
Copy Number:
Low Copy
Promoter:
araBAD
Growth Temperature:
30℃

pMRE107_PnptII_mTq2 vector Map

pMRE107_PnptII_mTq213617 bp600120018002400300036004200480054006000660072007800840090009600102001080011400120001260013200araCaraBAD promoterTransposon Tn7 transposition protein TnsBtnsDrrnB T1 terminatorrrnB T2 terminatorAmpR promoterAmpRoriTpSC101 oriRep101(Ts)Tn7LnptII promotermTurquoise2Tn7 right end

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pMRE107_PnptII_mTq2 vector Sequence

LOCUS       V004474                13617 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004474
VERSION     V004474
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 13617)
  AUTHORS   Remus-Emsermann MNP., Gisler P, Drissner D.
  TITLE     MiniTn7-transposon delivery vectors for inducible or constitutive
            fluorescent protein expression in Enterobacteriaceae
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 13617)
  AUTHORS   Remus-Emsermann MNP., Drissner D.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAR-2016) Institute for Food Sciences, Agroscope,
            Schloss 1, Waedenswil, Zurich 8820, Switzerland
REFERENCE   3  (bases 1 to 13617)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 13617)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (23-MAR-2016) Institute for Food Sciences, Agroscope, Schloss 1,
            Waedenswil, Zurich 8820, Switzerland"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13617
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(149..1024)
                     /label="araC"
                     /note="L-arabinose regulatory protein"
     promoter        1051..1335
                     /label="araBAD promoter"
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite
                     direction (Guzman et al., 1995)"
     CDS             1453..2271
                     /gene="tnsA"
                     /label="Transposon Tn7 transposition protein TnsA"
                     /note="Transposon Tn7 transposition protein TnsA from
                     Escherichia coli. Accession#: P13988"
     CDS             2261..4366
                     /gene="tnsB"
                     /label="Transposon Tn7 transposition protein TnsB"
                     /note="Transposon Tn7 transposition protein TnsB from
                     Escherichia coli. Accession#: P13989"
     CDS             4366..6030
                     /gene="tnsC"
                     /label="Transposon Tn7 transposition protein TnsC"
                     /note="Transposon Tn7 transposition protein TnsC from
                     Escherichia coli. Accession#: P05846"
     CDS             6036..7562
                     /codon_start=1
                     /gene="tnsD"
                     /product="TnsD"
                     /label="tnsD"
                     /note="Tn7 transposition site-selector"
                     /protein_id="AMZ00023.1"
                     /translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT
                     LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV
                     HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR
                     AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY
                     QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA
                     FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ
                     LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA
                     VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY
                     QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE"
     gene            6036..7562
                     /gene="tnsD"
                     /label="tnsD"
     terminator      8196..8282
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      8374..8401
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        8420..8511
                     /label="AmpR promoter"
     CDS             8512..9369
                     /label="AmpR"
                     /note="beta-lactamase"
     oriT            complement(9543..9652)
                     /direction=LEFT
                     /label="oriT"
                     /note="incP origin of transfer"
     rep_origin      10392..10614
                     /label="pSC101 ori"
                     /note="low-copy replication origin that requires the Rep101
                     protein"
     CDS             10662..11609
                     /label="Rep101(Ts)"
                     /note="temperature-sensitive version of the RepA protein
                     needed for replication with the pSC101 origin (Armstrong et
                     al., 1984)"
     mobile_element  12045..12210
                     /label="Tn7L"
                     /note="mini-Tn7 element (left end of the Tn7 transposon)"
     regulatory      12294..12612
                     /label="nptII promoter"
                     /note="nptII promoter"
                     /regulatory_class="promoter"
     CDS             12642..13358
                     /label="mTurquoise2"
                     /note="enhanced monomeric variant of CFP (Goedhart et al.,
                     2012)"
     repeat_region   13406..13617
                     /label="Tn7 right end"
                     /note="Tn7 right end"