Basic Vector Information
- Vector Name:
- pMR361-K
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7836 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Narayanan AM, Ramsey MM, Stacy A, Whiteley M.
pMR361-K vector Map
pMR361-K vector Sequence
LOCUS 40924_32195 7836 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMR361-K, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7836) AUTHORS Narayanan AM, Ramsey MM, Stacy A, Whiteley M. TITLE Genomic resources for an oral pathogen JOURNAL Unpublished REFERENCE 2 (bases 1 to 7836) AUTHORS Ramsey MM. TITLE Direct Submission JOURNAL Submitted (13-MAR-2017) Department of Molecular Biosciences, The University of Texas at Austin, 2506 Speedway, NMS 3.254, Austin, TX 78712, USA REFERENCE 3 (bases 1 to 7836) TITLE Direct Submission REFERENCE 4 (bases 1 to 7836) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAR-2017) Department of Molecular Biosciences, The University of Texas at Austin, 2506 Speedway, NMS 3.254, Austin, TX 78712, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7836 /mol_type="other DNA" /organism="synthetic DNA construct" oriT 35..144 /label=oriT /note="incP origin of transfer" CDS 177..545 /label=traJ /note="oriT-recognizing protein" CDS 604..1344 /codon_start=1 /product="TraI" /label=TraI /protein_id="ARI46004.1" /translation="MRSIKKSDFAELVKYITDEQGKTERLGHVRVTNCEANTLPAVMAE VMATQHGNTRSEADKTYHLLVSFRAGEKPDAETLRAIEDRICAGLGFAEHQRVSAVHHD TDNLHIHIAINKIHPTRNTIHEPYRAYRALADLCATLERDYGLERDNHETRQRVSENRA NDMERHAGVESLVGWILYAGRIVAGITGATGAVAGAYIADITDGEDRARHFGLMSACFG VGMVAGPVAGGLLGAISLLPRAFR" promoter complement(1616..1720) /label=AmpR promoter rep_origin 1918..2506 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2794..2815 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2830..2860 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2868..2884 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2892..2908 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2962..4008 /codon_start=1 /product="transposase" /label=transposase /protein_id="ARI46007.1" /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI ALEGNYVE" mobile_element 4020..4098 /mobile_element_type="transposon:mariner" /label=ner /note="repeat end" promoter complement(4104..4122) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 4123..4139 /note="M13 rev; common sequencing primer, one of multiple similar variants" CDS complement(4208..4999) /label=KanR /note="aminoglycoside phosphotransferase" promoter 5517..5535 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" mobile_element 5541..5640 /mobile_element_type="transposon:mariner" /label=ner /note="repeat end" CDS 6012..6686 /codon_start=1 /product="spectinomycin resistance cassette" /label=spectinomycin resistance cassette /note="SpcR" /protein_id="ARI46006.1" /translation="MFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLY QAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILT MDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLK KL" rep_origin complement(6871..7227) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.