Basic Vector Information
- Vector Name:
- pMQ71
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9312 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA.
- Promoter:
- TEF
pMQ71 vector Map
pMQ71 vector Sequence
LOCUS 40924_32135 9312 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMQ71, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9312) AUTHORS Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA. TITLE Saccharomyces cerevisiae-based molecular tool kit for manipulation of genes from gram-negative bacteria JOURNAL Appl. Environ. Microbiol. 72 (7), 5027-5036 (2006) PUBMED 16820502 REFERENCE 2 (bases 1 to 9312) AUTHORS Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (17-MAY-2006) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 9312) TITLE Direct Submission REFERENCE 4 (bases 1 to 9312) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2006"; volume: "72"; issue: "7"; pages: "5027-5036" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-MAY-2006) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9312 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 87..887 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" protein_bind 1050..1083 /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." gene complement(1146..2502) /label=kanMX /note="yeast selectable marker conferring kanamycin resistance (Wach et al., 1994)" protein_bind complement(2557..2590) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." rep_origin complement(2641..2992) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 3006..3836 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" terminator complement(4038..4124) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" misc_feature complement(4327..4383) /label=MCS /note="pUC18/19 multiple cloning site" promoter complement(4404..4688) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 4715..5590 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" rep_origin complement(5948..6536) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6748..7278) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(7467..7495) /label=Pc promoter /note="class 1 integron promoter" rep_origin complement(7572..8914) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication" promoter 9178..9312 /label=URA3 promoter
This page is informational only.