Basic Vector Information
- Vector Name:
- pMQ64
- Antibiotic Resistance:
- Gentamicin
- Length:
- 6705 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA.
- Promoter:
- Pc
pMQ64 vector Map
pMQ64 vector Sequence
LOCUS 40924_32125 6705 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMQ64, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6705) AUTHORS Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA. TITLE Saccharomyces cerevisiae-based molecular tool kit for manipulation of genes from gram-negative bacteria JOURNAL Appl. Environ. Microbiol. 72 (7), 5027-5036 (2006) PUBMED 16820502 REFERENCE 2 (bases 1 to 6705) AUTHORS Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (17-MAY-2006) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 6705) TITLE Direct Submission REFERENCE 4 (bases 1 to 6705) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2006"; volume: "72"; issue: "7"; pages: "5027-5036" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-MAY-2006) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6705 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 87..887 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" oriT complement(979..1087) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind complement(1284..1317) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." rep_origin complement(1368..1719) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 1733..2563 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" primer_bind 2727..2743 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 2753..2771 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(2780..2887) /label=MCS /note="pBluescript multiple cloning site" promoter complement(2900..2918) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2939..2955) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2963..2979) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2987..3017) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3032..3053) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3341..3929) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4141..4671) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(4860..4888) /label=Pc promoter /note="class 1 integron promoter" rep_origin complement(4965..6307) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication" promoter 6571..6705 /label=URA3 promoter
This page is informational only.