Basic Vector Information
- Vector Name:
- pMQ30
- Antibiotic Resistance:
- Gentamicin
- Length:
- 7454 bp
- Type:
- Shuttle/allelic-replacement vector
- Replication origin:
- ori
- Source/Author:
- Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'toole GA.
- Promoter:
- sacB
pMQ30 vector Map
pMQ30 vector Sequence
LOCUS 40924_32065 7454 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle/allelic-replacement vector pMQ30, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7454) AUTHORS Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, O'toole GA. TITLE Saccharomyces cerevisiae-Based Molecular Tool Kit for Manipulation of Genes from Gram-Negative Bacteria JOURNAL Appl. Environ. Microbiol. 72 (7), 5027-5036 (2006) PUBMED 16820502 REFERENCE 2 (bases 1 to 7454) AUTHORS Shanks RMQ., Caiazza NC, Hinsa SM, Toutain CM, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (14-SEP-2005) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 7454) TITLE Direct Submission REFERENCE 4 (bases 1 to 7454) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2006"; volume: "72"; issue: "7"; pages: "5027-5036" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-SEP-2005) Microbiology and Immunology, Dartmouth Medical School, Vail Building Room 505, Hanover, NH 03755, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7454 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(212..1630) /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" promoter complement(1631..2076) /label=sacB promoter /note="sacB promoter and control region" oriT complement(2450..2559) /direction=LEFT /label=oriT /note="incP origin of transfer" terminator complement(2980..3007) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(3099..3185) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 3535..3551 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(3555..3611) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(3621..3637) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3645..3661) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3669..3699) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3714..3735) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4023..4611) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4867..5397) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(5586..5614) /label=Pc promoter /note="class 1 integron promoter" promoter complement(5632..5736) /label=AmpR promoter CDS complement(5836..6636) /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" promoter complement(6637..6857) /label=URA3 promoter misc_feature 6885..7388 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.