Basic Vector Information
- Vector Name:
- pMQ2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8636 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
- Promoter:
- URA3
pMQ2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMQ2 vector Sequence
LOCUS V004515 8636 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004515 VERSION V004515 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8636) AUTHORS Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA. TITLE New yeast recombineering tools for bacteria JOURNAL Plasmid 62 (2), 88-97 (2009) PUBMED 19477196 REFERENCE 2 (bases 1 to 8636) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE In vivo recombination vectors for modification and expression of genes in Gram-negative and Gram-positive bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 8636) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (03-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA REFERENCE 4 (bases 1 to 8636) TITLE Direct Submission REFERENCE 5 (bases 1 to 8636) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "62"; issue: "2"; pages: "88-97" SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (03-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA" SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..8636 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 196..416 /label="URA3 promoter" CDS 417..1217 /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" rep_origin complement(1351..1806) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 1951..1967 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 1977..1995 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 2021..2037 /label="KS primer" /note="common sequencing primer, one of multiple similar variants" rep_origin 2274..2431 /label="palA lagging strand origin" /note="palA lagging strand origin" CDS complement(2573..3220) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(3389..3772) /codon_start=1 /gene="rep" /product="replication protein" /label="rep" /protein_id="ACB45180.1" /translation="MHLILSNMTFNKFLKYLISLFFLSILFHVITHKNNLVFTNYDNKK SCFFPFLCMFFTSHLKRYINRYEKATFFALKTSHTNNLRVTSLAGNSYPYYQDKKEKDF SLRSNPLKKHKRPHFLMWSLFFN" gene complement(3389..3772) /gene="rep" /label="rep" rep_origin 3427..3555 /label="oriV for pC194" /note="oriV for pC194" CDS 3677..4366 /codon_start=1 /gene="pre" /product="Pre" /label="pre" /note="pC194 OrfA" /protein_id="ACB45181.1" /translation="MCYNMEKYTEKKQRNQVFQKFIKRHIGENQMDLVEDCNTFLSFVA DKTLEKQKLYKANSCKNRFCPVCAWRKARKDALGLSLMMQYIKQQEKKEFIFLTLTTPN VMSDELENEIKRYNNSFRKLIKRKKVGSVIKGYVRKLEITYNKKRDDYNPHFHVLIAVN KSYFTDKRYYISQQEWLDLWRDVTGISEITQVQVQKIRQNNNKELYEMAKYSGKDSDYL INKSKSL" gene 3677..4366 /gene="pre" /label="pre" misc_feature 4613..4699 /label="palB" /note="palB" CDS 4713..4727 /label="enterokinase site" /note="enterokinase recognition and cleavage site" primer_bind complement(4981..4997) /label="SK primer" /note="common sequencing primer, one of multiple similar variants" promoter complement(5034..5052) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(5073..5089) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5097..5113) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5121..5151) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(5166..5187) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5475..6063) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6237..7094) /label="AmpR" /note="beta-lactamase" promoter complement(7095..7199) /label="AmpR promoter" rep_origin complement(7226..8568) /direction=LEFT /label="2u ori" /note="yeast 2u plasmid origin of replication"
This page is informational only.