Basic Vector Information
- Vector Name:
- pMQ175
- Antibiotic Resistance:
- Gentamicin
- Length:
- 6996 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
- Promoter:
- araBAD
pMQ175 vector Map
pMQ175 vector Sequence
LOCUS 40924_32025 6996 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMQ175, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6996) AUTHORS Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA. TITLE New yeast recombineering tools for bacteria JOURNAL Plasmid 62 (2), 88-97 (2009) PUBMED 19477196 REFERENCE 2 (bases 1 to 6996) AUTHORS Shanks RMQ., Kadouri DE, O'Toole GA. TITLE Recombineering vectors for a wide range of Gram-negative and -positive bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 6996) AUTHORS Shanks RMQ., Kadouri DE, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (13-OCT-2008) Ophthalmololgy, University of Pittsburgh, 203 Lothrop St, Pittsburgh, PA 15213, USA REFERENCE 4 (bases 1 to 6996) TITLE Direct Submission REFERENCE 5 (bases 1 to 6996) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "62"; issue: "2"; pages: "88-97" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (13-OCT-2008) Ophthalmololgy, University of Pittsburgh, 203 Lothrop St, Pittsburgh, PA 15213, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..6996 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..801 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" oriT complement(893..1001) /direction=LEFT /label=oriT /note="incP origin of transfer" promoter complement(1192..1210) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin 1419..1807 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" terminator complement(1890..1976) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 2312..2328 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 2338..2356 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(2365..2472) /label=MCS /note="pBluescript multiple cloning site" promoter complement(2485..2503) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" promoter complement(2546..2830) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 2857..3732 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" rep_origin 4091..4635 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(5098..5628) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(5817..5845) /label=Pc promoter /note="class 1 integron promoter" promoter complement(5863..5971) /label=AmpR promoter misc_feature 6008..6511 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 6776..6996 /label=URA3 promoter
This page is informational only.