Basic Vector Information
- Vector Name:
- pMQ156
- Antibiotic Resistance:
- Gentamicin
- Length:
- 6032 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Host:
- Yeast
- Source/Author:
- Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
- Promoter:
- URA3
pMQ156 vector Vector Map
pMQ156 vector Sequence
LOCUS 40924_32020 6032 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMQ156, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6032) AUTHORS Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA. TITLE New yeast recombineering tools for bacteria JOURNAL Plasmid 62 (2), 88-97 (2009) PUBMED 19477196 REFERENCE 2 (bases 1 to 6032) AUTHORS Shanks RMQ., Kadouri DE, O'Toole GA. TITLE Recombineering vectors for a wide range of Gram-negative and -positive bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 6032) AUTHORS Shanks RMQ., Kadouri DE, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (13-OCT-2008) Ophthalmololgy, University of Pittsburgh, 203 Lothrop St, Pittsburgh, PA 15213, USA REFERENCE 4 (bases 1 to 6032) TITLE Direct Submission REFERENCE 5 (bases 1 to 6032) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "62"; issue: "2"; pages: "88-97" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (13-OCT-2008) Ophthalmololgy, University of Pittsburgh, 203 Lothrop St, Pittsburgh, PA 15213, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..6032 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..801 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" oriT complement(893..1001) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind complement(1198..1231) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." rep_origin complement(1282..1633) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 1647..2477 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" terminator complement(2679..2765) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 3115..3131 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(3135..3191) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(3201..3217) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3225..3241) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3249..3279) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3294..3315) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter complement(3366..3384) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin 3593..3981 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(4134..4664) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(4853..4881) /label=Pc promoter /note="class 1 integron promoter" promoter complement(4899..5007) /label=AmpR promoter misc_feature 5044..5547 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 5812..6032 /label=URA3 promoter
This page is informational only.