Basic Vector Information
- Vector Name:
- pMQ125
- Antibiotic Resistance:
- Gentamicin
- Length:
- 7785 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA.
- Promoter:
- araBAD
pMQ125 vector Map
pMQ125 vector Sequence
LOCUS 40924_32000 7785 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMQ125, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7785) AUTHORS Shanks RM, Kadouri DE, MacEachran DP, O'Toole GA. TITLE New yeast recombineering tools for bacteria JOURNAL Plasmid 62 (2), 88-97 (2009) PUBMED 19477196 REFERENCE 2 (bases 1 to 7785) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE In vivo recombination vectors for modification and expression of genes in Gram-negative and Gram-positive bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 7785) AUTHORS Shanks RM, MacEachran DP, Powers SZ, Kadouri DE, O'Toole GA. TITLE Direct Submission JOURNAL Submitted (04-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA REFERENCE 4 (bases 1 to 7785) TITLE Direct Submission REFERENCE 5 (bases 1 to 7785) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "62"; issue: "2"; pages: "88-97" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (04-MAR-2008) Ophthalmology, University of Pittsburgh, 203 Lothrop St., Pittsburgh, PA 15213, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..7785 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..801 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" oriT complement(893..1001) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind complement(1198..1231) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." rep_origin complement(1282..1633) /direction=LEFT /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS 1647..2477 /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" terminator complement(2679..2765) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 3101..3117 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3127..3145 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(3154..3261) /label=MCS /note="pBluescript multiple cloning site" promoter complement(3274..3292) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" promoter complement(3335..3619) /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 3646..4521 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" rep_origin 4880..5424 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(5887..6417) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(6606..6634) /label=Pc promoter /note="class 1 integron promoter" promoter complement(6652..6760) /label=AmpR promoter misc_feature 6797..7300 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 7565..7785 /label=URA3 promoter
This page is informational only.