Basic Vector Information
- Vector Name:
- pRS416 pRS-She3-TG
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8474 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Belmont BJ, Niles JC.
- Promoter:
- URA3
pRS416 pRS-She3-TG vector Map
pRS416 pRS-She3-TG vector Sequence
LOCUS V003591 8474 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003591 VERSION V003591 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8474) AUTHORS Belmont BJ, Niles JC. TITLE Inducible Control of Subcellular RNA Localization Using a Synthetic Protein-RNA Aptamer Interaction JOURNAL PLoS ONE 7 (10), E46868 (2012) PUBMED 23056498 REFERENCE 2 (bases 1 to 8474) AUTHORS Belmont BJ, Niles JC. TITLE Direct Submission JOURNAL Submitted (12-SEP-2012) Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Ave, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 8474) TITLE Direct Submission REFERENCE 4 (bases 1 to 8474) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "10"; pages: "E46868" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-SEP-2012) Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Ave, Cambridge, MA 02139, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8474 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 196..416 /label="URA3 promoter" CDS 417..1217 /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" rep_origin complement(1351..1806) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 1951..1967 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 1977..1995 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 2269..2386 /label="UAS" /note="upstream activating sequence mediating Gal4-dependent induction" CDS 2735..4009 /gene="SHE3" /label="SWI5-dependent HO expression protein 3" /note="SWI5-dependent HO expression protein 3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c). Accession#: P38272" CDS 4028..4645 /codon_start=1 /gene="tetR from transposon Tn10" /product="tetracycline repressor TetR" /label="TetR" /note="TetR binds to the tetracycline operator tetO to inhibit transcription. This inhibition can be relieved by adding tetracycline or doxycycline." /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESG" CDS complement(4650..4676) /label="9xHis" /note="9xHis affinity tag" CDS 4676..5389 /label="EGFP" /note="enhanced GFP" promoter complement(5700..5718) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(5739..5755) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5763..5779) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5787..5817) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(5832..5853) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(6141..6729) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6903..7760) /label="AmpR" /note="beta-lactamase" promoter complement(7761..7865) /label="AmpR promoter" misc_feature 7902..8405 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.