Basic Vector Information
- Vector Name:
- pRS304 vYFPdel-5-1.2(5')
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5771 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Belmont BJ, Niles JC.
- Promoter:
- TRP1
pRS304 vYFPdel-5-1.2(5') vector Vector Map
pRS304 vYFPdel-5-1.2(5') vector Sequence
LOCUS 40924_37763 5771 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRS304 vYFPdel-5-1.2(5'), complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5771) AUTHORS Belmont BJ, Niles JC. TITLE Inducible Control of Subcellular RNA Localization Using a Synthetic Protein-RNA Aptamer Interaction JOURNAL PLoS ONE 7 (10), E46868 (2012) PUBMED 23056498 REFERENCE 2 (bases 1 to 5771) AUTHORS Belmont BJ, Niles JC. TITLE Direct Submission JOURNAL Submitted (12-SEP-2012) Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Ave, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 5771) TITLE Direct Submission REFERENCE 4 (bases 1 to 5771) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "10"; pages: "E46868" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-SEP-2012) Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Ave, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5771 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 185..465 /label=TRP1 promoter CDS 466..1137 /codon_start=1 /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA KK" rep_origin complement(1237..1692) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 1837..1853 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 1860..1878 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS complement(2269..2940) /codon_start=1 /label=(3-F)Tyr-EGFP /note="(3-F)Tyr-EGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Aequorea victoria." /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKL ICTTGKLPVPWPTLVTTLGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKAN FKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEF VT" promoter complement(3511..3529) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(3550..3566) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3574..3590) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3598..3628) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3643..3664) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3952..4540) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4714..5571) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(5572..5676) /label=AmpR promoter
This page is informational only.