Basic Vector Information
- Vector Name:
- pRS002
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4265 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Ghosh IN, Landick R.
pRS002 vector Map
pRS002 vector Sequence
LOCUS 40924_37728 4265 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRS002, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4265) AUTHORS Ghosh IN, Landick R. TITLE OptSSeq: High-throughput sequencing readout of growth enrichment defines optimal gene expression elements for homoethanologenesis JOURNAL ACS Synth Biol (2016) In press PUBMED 27404024 REFERENCE 2 (bases 1 to 4265) AUTHORS Ghosh IN, Landick RC. TITLE Direct Submission JOURNAL Submitted (15-JUL-2016) DOE Great Lakes Bioenergy Research Center, University of Wisconsin-Madison, 1552 University Avenue, Madison, WI 53726, United States REFERENCE 3 (bases 1 to 4265) TITLE Direct Submission REFERENCE 4 (bases 1 to 4265) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth Biol (2016) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUL-2016) DOE Great Lakes Bioenergy Research Center, University of Wisconsin-Madison, 1552 University Avenue, Madison, WI 53726, United States" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4265 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1903..1994 /label=AmpR promoter CDS 1995..2783 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" CDS complement(3361..4020) /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" rep_origin complement(join(4021..4265,1..525)) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.