Basic Vector Information
- Vector Name:
- pRR01
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5554 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Ramsden R, Arms L, Davis TN, Muller EG.
pRR01 vector Vector Map
pRR01 vector Sequence
LOCUS 40924_37623 5554 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRR01, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5554) AUTHORS Ramsden R, Arms L, Davis TN, Muller EG. TITLE An intein with genetically selectable markers provides a new approach to internally label proteins with GFP JOURNAL BMC Biotechnol. 11 (1), 71 (2011) PUBMED 21708017 REFERENCE 2 (bases 1 to 5554) AUTHORS Ramsden R, Arms L, Davis TN, Muller EGD. TITLE Direct Submission JOURNAL Submitted (30-JUN-2011) Biochemistry, University of Washington, 1705 NE Pacific St, HSB J461, Seattle, WA 98195, USA REFERENCE 3 (bases 1 to 5554) TITLE Direct Submission REFERENCE 4 (bases 1 to 5554) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Biotechnol."; date: "2011"; volume: "11"; issue: "1"; pages: "71" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JUN-2011) Biochemistry, University of Washington, 1705 NE Pacific St, HSB J461, Seattle, WA 98195, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5554 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 183..211 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 219..235 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 258..911 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 918..935 /codon_start=1 /label=thrombin site /note="thrombin recognition and cleavage site" /translation="LVPRGS" CDS 1497..1514 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" promoter 1857..1961 /label=AmpR promoter CDS 1962..2819 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2993..3581 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 3825..3902 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 3903..4982 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 4998..5019 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 5034..5064 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 5072..5088 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 5108..5281 /codon_start=1 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART DRPSQQLRSLNGE"
This page is informational only.