pRMU824 vector (V003666)

LOCUS       40924_37448        4012 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pRMU824, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4012)
  AUTHORS   Stanislauskiene R, Gasparaviciute R, Vaitekunas J, Meskiene R, 
            Rutkiene R, Casaite V, Meskys R.
  TITLE     Construction of Escherichia coli-Arthrobacter-Rhodococcus shuttle 
            vectors based on a cryptic plasmid from Arthrobacter rhombi and 
            investigation of their application for functional screening
  JOURNAL   FEMS Microbiol. Lett. 327 (1), 78-86 (2012)
  PUBMED    22098420
REFERENCE   2  (bases 1 to 4012)
  AUTHORS   Stanislauskiene R.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-NOV-2010) Molecular Microbiology and Biotechnology, 
            Vilnius University Institute of Biochemistry, Mokslininku 12, 
            Vilnius LT-08662, Lithuania
REFERENCE   3  (bases 1 to 4012)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4012)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "FEMS 
            Microbiol. Lett."; date: "2012"; volume: "327"; issue: "1"; pages: 
            "78-86"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (16-NOV-2010) Molecular Microbiology and Biotechnology, Vilnius 
            University Institute of Biochemistry, Mokslininku 12, Vilnius 
            LT-08662, Lithuania"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4012
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    274..295
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        310..340
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    348..364
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     372..388
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        407..425
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(509..525)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(687..953)
                     /codon_start=1
                     /gene="repB"
                     /product="DNA-binding protein RepB"
                     /label=repB
                     /protein_id="AER68062.1"
                     /translation="MSALDPRRRKITAREAAEQVGCTPRHIRSVVAEPRHEFLARAAER
                     QRKAADWKDEGLTYREIAERLDCTPKAAENLVLRGRKARKVTA"
     gene            complement(687..953)
                     /gene="repB"
                     /label=repB
     CDS             complement(953..1792)
                     /codon_start=1
                     /gene="repA"
                     /product="RepA"
                     /label=repA
                     /protein_id="AER68063.1"
                     /translation="MMTAERWAEHYRQKWPMATDHDKGRFPVRQSRADALKRRYIQANP
                     AALTTQIVIDLDHEDSLGLALELNGVPTPNYVAQSPSGHAHVAYLLAAPVCRTDNARLE
                     PMKFAARVERGLVNALRADLGYAGFMTKNPIHDGWDTVWTNDHLWTLGELATQLSGWLP
                     RSLPRRAADNSGLGRNVALFNDVRLWSYRAIRKHWEAGPDAWEQATYAYALAVNHKFAV
                     PLDASEVVHLARSVSRWTWRNFTPEGFSKVQTRRSQKAAAVRTAEKIVKAELIRSLV"
     gene            complement(953..1792)
                     /gene="repA"
                     /label=repA
     CDS             complement(2051..2707)
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(2708..2810)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(3336..3881)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."