Basic Vector Information
- Vector Name:
- pRMTn-Tc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8886 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Miyazaki R, van der Meer JR.
- Promoter:
- tet
pRMTn-Tc vector Vector Map
pRMTn-Tc vector Sequence
LOCUS 40924_37443 8886 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRMTn-Tc DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8886) AUTHORS Miyazaki R, van der Meer JR. TITLE A New Large-DNA-Fragment Delivery System Based on Integrase Activity from an Integrative and Conjugative Element JOURNAL Appl. Environ. Microbiol. 79 (14), 4440-4447 (2013) PUBMED 23686268 REFERENCE 2 (bases 1 to 8886) AUTHORS Miyazaki R, van der Meer JR. TITLE Direct Submission JOURNAL Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland REFERENCE 3 (bases 1 to 8886) TITLE Direct Submission REFERENCE 4 (bases 1 to 8886) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2013"; volume: "79"; issue: "14"; pages: "4440-4447" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8886 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..19 /label=Tn5 ME /note="hyperactive mosaic end for Tn5 transposase recognition (Reznikoff et al., 2004)" misc_feature 38..85 /label=FRT /note="FRT" protein_bind complement(38..85) /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." oriT 225..333 /label=oriT /note="incP origin of transfer" promoter 420..448 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 496..1683 /label=TcR /note="tetracycline efflux protein" protein_bind complement(2752..2799) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." CDS complement(3157..5130) /codon_start=1 /gene="intB13" /product="P4-type integrase" /label=intB13 /protein_id="BAN28920.1" /translation="MTSIGPKSLLRSLEMALSDLIVRQAKTTGKRYTLYDNDCLSLMVS AAGGKSWMFRYSWLGKQKRMALGGYPALSLREARAERDKAQALIARGIDPQIERDQRRH AAKLAGEYTFKNVFDAWVEHRRKELKEGRQSTLSQILRIFNKDVLPTLGKMSIYDIRRP QLLGVLAAIEKRKAFTTAEKVRTWFNQMFRYALVIAEGLEVNPAADLDVVAEPKPPVAH NPYLHLPELPEFLQKLRRYNPRGWQTQLGVRLLFLTGVRTGELRLAEPEQFDLDRGFWI IPPEVVKQLQDEMRKAGKRPQDVPPYIVPLSLQAIEIVRYLLGVMRPAQKYLLSHRSEL KKRISENTLNKAVQLMGYEGRLTGHGIRGTISTALNEIGYPKIWVDAQLSHSDPNKVSS AYNHAKYVEPRRRMMQDWADRLDLLEQGEVQAASAHLTIRIDGVPAMAEVEEAVDVAPT VAEPGVSGSPPVAATPIVVTPNSGGITFQRLSQVPPPPAHAPESEVSAIQREREEMLAM YESPNNLPVALFGKLAGKSKDQINRELKAGKLLSISLGNRGQRVPDWQLVPLKRRLAQA LMNQCPHVDSWALYRLLTKPHSNLGNRAAIDVVTPTNVGKVLQAVTPYKEFERSSTDET PQFSEFVRQLQRHVNALEEAPC" gene complement(3157..5130) /gene="intB13" /label=intB13 protein_bind complement(5226..5242) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 5334..5351 /label=attP /note="attP" regulatory 5420..5448 /label=Pcirc /note="Pcirc" /regulatory_class="promoter" terminator complement(5510..5596) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator complement(5699..5793) /label=lambda t0 terminator /note="transcription terminator from phage lambda" misc_feature 5794..5838 /label=multiple cloning site /note="multiple cloning site" misc_feature complement(5876..5894) /label=Tn5 ME /note="hyperactive mosaic end for Tn5 transposase recognition (Reznikoff et al., 2004)" rep_origin complement(5909..6297) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" terminator complement(6314..6353) /label=fd terminator /note="central terminator from bacteriophage fd (Otsuka and Kunisawa, 1982)" CDS complement(6360..7217) /label=AmpR /note="beta-lactamase" promoter complement(7218..7309) /label=AmpR promoter CDS complement(7366..8793) /label=Tn5 transposase /note="transposase from the bacterial Tn5 transposon (Reznikoff, 1993)"
This page is informational only.