Basic Vector Information
- Vector Name:
- pRMR6K-Tc
- Antibiotic Resistance:
- Tetracycline
- Length:
- 6188 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Miyazaki R, van der Meer JR.
- Promoter:
- tet
pRMR6K-Tc vector Map
pRMR6K-Tc vector Sequence
LOCUS 40924_37428 6188 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRMR6K-Tc DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6188) AUTHORS Miyazaki R, van der Meer JR. TITLE A New Large-DNA-Fragment Delivery System Based on Integrase Activity from an Integrative and Conjugative Element JOURNAL Appl. Environ. Microbiol. 79 (14), 4440-4447 (2013) PUBMED 23686268 REFERENCE 2 (bases 1 to 6188) AUTHORS Miyazaki R, van der Meer JR. TITLE Direct Submission JOURNAL Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland REFERENCE 3 (bases 1 to 6188) TITLE Direct Submission REFERENCE 4 (bases 1 to 6188) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2013"; volume: "79"; issue: "14"; pages: "4440-4447" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6188 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(1069..2256) /label=TcR /note="tetracycline efflux protein" promoter complement(2304..2332) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" oriT complement(2419..2527) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind 2667..2714 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." rep_origin 2721..3109 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" misc_feature 3111..3146 /label=multiple cloning site /note="multiple cloning site" terminator 3147..3241 /label=lambda t0 terminator /note="transcription terminator from phage lambda" terminator 3344..3430 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" regulatory 3492..3520 /label=Pcirc /note="Pcirc" /regulatory_class="promoter" misc_feature 3589..3606 /label=attP /note="attP" protein_bind 3698..3714 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 3810..5783 /codon_start=1 /gene="intB13" /product="P4-type integrase" /label=intB13 /protein_id="BAN28914.1" /translation="MTSIGPKSLLRSLEMALSDLIVRQAKTTGKRYTLYDNDCLSLMVS AAGGKSWMFRYSWLGKQKRMALGGYPALSLREARAERDKAQALIARGIDPQIERDQRRH AAKLAGEYTFKNVFDAWVEHRRKELKEGRQSTLSQILRIFNKDVLPTLGKMSIYDIRRP QLLGVLAAIEKRKAFTTAEKVRTWFNQMFRYALVIAEGLEVNPAADLDVVAEPKPPVAH NPYLHLPELPEFLQKLRRYNPRGWQTQLGVRLLFLTGVRTGELRLAEPEQFDLDRGFWI IPPEVVKQLQDEMRKAGKRPQDVPPYIVPLSLQAIEIVRYLLGVMRPAQKYLLSHRSEL KKRISENTLNKAVQLMGYEGRLTGHGIRGTISTALNEIGYPKIWVDAQLSHSDPNKVSS AYNHAKYVEPRRRMMQDWADRLDLLEQGEVQAASAHLTIRIDGVPAMAEVEEAVDVAPT VAEPGVSGSPPVAATPIVVTPNSGGITFQRLSQVPPPPAHAPESEVSAIQREREEMLAM YESPNNLPVALFGKLAGKSKDQINRELKAGKLLSISLGNRGQRVPDWQLVPLKRRLAQA LMNQCPHVDSWALYRLLTKPHSNLGNRAAIDVVTPTNVGKVLQAVTPYKEFERSSTDET PQFSEFVRQLQRHVNALEEAPC" gene 3810..5783 /gene="intB13" /label=intB13 misc_feature 6141..6188 /label=FRT /note="FRT" protein_bind 6141..6188 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)."
This page is informational only.