Basic Vector Information
- Vector Name:
- pRMR6K-Km
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5017 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Miyazaki R, van der Meer JR.
pRMR6K-Km vector Map
pRMR6K-Km vector Sequence
LOCUS 40924_37423 5017 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRMR6K-Km DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5017) AUTHORS Miyazaki R, van der Meer JR. TITLE A New Large-DNA-Fragment Delivery System Based on Integrase Activity from an Integrative and Conjugative Element JOURNAL Appl. Environ. Microbiol. 79 (14), 4440-4447 (2013) PUBMED 23686268 REFERENCE 2 (bases 1 to 5017) AUTHORS Miyazaki R, van der Meer JR. TITLE Direct Submission JOURNAL Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland REFERENCE 3 (bases 1 to 5017) TITLE Direct Submission REFERENCE 4 (bases 1 to 5017) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2013"; volume: "79"; issue: "14"; pages: "4440-4447" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5017 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(178..969) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" oriT complement(1248..1356) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind 1496..1543 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." rep_origin 1550..1938 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" misc_feature 1940..1975 /label=multiple cloning site /note="multiple cloning site" terminator 1976..2070 /label=lambda t0 terminator /note="transcription terminator from phage lambda" terminator 2173..2259 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" regulatory 2321..2349 /label=Pcirc /note="Pcirc" /regulatory_class="promoter" misc_feature 2418..2435 /label=attP /note="attP" protein_bind 2527..2543 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 2639..4612 /codon_start=1 /gene="intB13" /product="P4-type integrase" /label=intB13 /protein_id="BAN28916.1" /translation="MTSIGPKSLLRSLEMALSDLIVRQAKTTGKRYTLYDNDCLSLMVS AAGGKSWMFRYSWLGKQKRMALGGYPALSLREARAERDKAQALIARGIDPQIERDQRRH AAKLAGEYTFKNVFDAWVEHRRKELKEGRQSTLSQILRIFNKDVLPTLGKMSIYDIRRP QLLGVLAAIEKRKAFTTAEKVRTWFNQMFRYALVIAEGLEVNPAADLDVVAEPKPPVAH NPYLHLPELPEFLQKLRRYNPRGWQTQLGVRLLFLTGVRTGELRLAEPEQFDLDRGFWI IPPEVVKQLQDEMRKAGKRPQDVPPYIVPLSLQAIEIVRYLLGVMRPAQKYLLSHRSEL KKRISENTLNKAVQLMGYEGRLTGHGIRGTISTALNEIGYPKIWVDAQLSHSDPNKVSS AYNHAKYVEPRRRMMQDWADRLDLLEQGEVQAASAHLTIRIDGVPAMAEVEEAVDVAPT VAEPGVSGSPPVAATPIVVTPNSGGITFQRLSQVPPPPAHAPESEVSAIQREREEMLAM YESPNNLPVALFGKLAGKSKDQINRELKAGKLLSISLGNRGQRVPDWQLVPLKRRLAQA LMNQCPHVDSWALYRLLTKPHSNLGNRAAIDVVTPTNVGKVLQAVTPYKEFERSSTDET PQFSEFVRQLQRHVNALEEAPC" gene 2639..4612 /gene="intB13" /label=intB13 misc_feature 4970..5017 /label=FRT /note="FRT" protein_bind 4970..5017 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)."
This page is informational only.