Basic Vector Information
- Vector Name:
- pRMR6K-Gm
- Antibiotic Resistance:
- Gentamicin
- Length:
- 4608 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Miyazaki R, van der Meer JR.
- Promoter:
- Pc
pRMR6K-Gm vector Map
pRMR6K-Gm vector Sequence
LOCUS 40924_37418 4608 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRMR6K-Gm DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4608) AUTHORS Miyazaki R, van der Meer JR. TITLE A New Large-DNA-Fragment Delivery System Based on Integrase Activity from an Integrative and Conjugative Element JOURNAL Appl. Environ. Microbiol. 79 (14), 4440-4447 (2013) PUBMED 23686268 REFERENCE 2 (bases 1 to 4608) AUTHORS Miyazaki R, van der Meer JR. TITLE Direct Submission JOURNAL Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland REFERENCE 3 (bases 1 to 4608) TITLE Direct Submission REFERENCE 4 (bases 1 to 4608) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2013"; volume: "79"; issue: "14"; pages: "4440-4447" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JAN-2013) Contact:Ryo Miyazaki University of Lausanne, Department of Fundamental Microbiology; Batiment Biophore, Quartier UNIL-Sorge, Lausanne 1015, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4608 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(78..608) /label=GmR /note="gentamycin acetyltransferase" promoter complement(797..825) /label=Pc promoter /note="class 1 integron promoter" oriT complement(839..947) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind 1087..1134 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." rep_origin 1141..1529 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" misc_feature 1531..1566 /label=multiple cloning site /note="multiple cloning site" terminator 1567..1661 /label=lambda t0 terminator /note="transcription terminator from phage lambda" terminator 1764..1850 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" regulatory 1912..1940 /label=Pcirc /note="Pcirc" /regulatory_class="promoter" misc_feature 2009..2026 /label=attP /note="attP" protein_bind 2118..2134 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 2230..4203 /codon_start=1 /gene="intB13" /product="P4-type integrase" /label=intB13 /protein_id="BAN28918.1" /translation="MTSIGPKSLLRSLEMALSDLIVRQAKTTGKRYTLYDNDCLSLMVS AAGGKSWMFRYSWLGKQKRMALGGYPALSLREARAERDKAQALIARGIDPQIERDQRRH AAKLAGEYTFKNVFDAWVEHRRKELKEGRQSTLSQILRIFNKDVLPTLGKMSIYDIRRP QLLGVLAAIEKRKAFTTAEKVRTWFNQMFRYALVIAEGLEVNPAADLDVVAEPKPPVAH NPYLHLPELPEFLQKLRRYNPRGWQTQLGVRLLFLTGVRTGELRLAEPEQFDLDRGFWI IPPEVVKQLQDEMRKAGKRPQDVPPYIVPLSLQAIEIVRYLLGVMRPAQKYLLSHRSEL KKRISENTLNKAVQLMGYEGRLTGHGIRGTISTALNEIGYPKIWVDAQLSHSDPNKVSS AYNHAKYVEPRRRMMQDWADRLDLLEQGEVQAASAHLTIRIDGVPAMAEVEEAVDVAPT VAEPGVSGSPPVAATPIVVTPNSGGITFQRLSQVPPPPAHAPESEVSAIQREREEMLAM YESPNNLPVALFGKLAGKSKDQINRELKAGKLLSISLGNRGQRVPDWQLVPLKRRLAQA LMNQCPHVDSWALYRLLTKPHSNLGNRAAIDVVTPTNVGKVLQAVTPYKEFERSSTDET PQFSEFVRQLQRHVNALEEAPC" gene 2230..4203 /gene="intB13" /label=intB13 misc_feature 4561..4608 /label=FRT /note="FRT" protein_bind 4561..4608 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)."
This page is informational only.