Basic Vector Information
- Vector Name:
- pRM-vgb
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8933 bp
- Type:
- Protein fusion vector
- Replication origin:
- oriV
- Source/Author:
- Mora-Lugo R, Madrigal M, Yelemane V, Fernandez-Lahore M.
- Promoter:
- trpC
pRM-vgb vector Map
pRM-vgb vector Sequence
LOCUS 40924_37373 8933 bp DNA circular SYN 18-DEC-2018 DEFINITION Protein fusion vector pRM-vgb, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8933) AUTHORS Mora-Lugo R, Madrigal M, Yelemane V, Fernandez-Lahore M. TITLE Improved biomass and protein production in solid-state cultures of an Aspergillus sojae strain harboring the Vitreoscilla hemoglobin JOURNAL Appl. Microbiol. Biotechnol. 99 (22), 9699-9708 (2015) PUBMED 26224427 REFERENCE 2 (bases 1 to 8933) AUTHORS Mora-Lugo R, Madrigal M, Yelemane V, Fernandez-Lahore M. TITLE Direct Submission JOURNAL Submitted (30-JUN-2015) School of Engineering and Science, Jacobs University Bremen gGmbH, Campus Ring 1, Bremen, Bremen 28759, Germany REFERENCE 3 (bases 1 to 8933) TITLE Direct Submission REFERENCE 4 (bases 1 to 8933) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Microbiol. Biotechnol."; date: "2015"; volume: "99"; issue: "22"; pages: "9699-9708" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JUN-2015) School of Engineering and Science, Jacobs University Bremen gGmbH, Campus Ring 1, Bremen, Bremen 28759, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8933 /mol_type="other DNA" /organism="synthetic DNA construct" intron 1177..1292 /label=gpdA intron /note="intron from the Aspergillus nidulans glyceraldehyde-3-phosphate dehydrogenase gene (Punt et al., 1990)" CDS 1802..2518 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" primer_bind complement(2554..2570) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(2806..2830) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS complement(2959..4104) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" CDS complement(4406..5197) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" rep_origin complement(5479..6110) /direction=LEFT /label=oriV /note="incP origin of replication" misc_feature complement(6249..6273) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" terminator complement(6389..6956) /label=trpC terminator /note="transcription terminator from the Aspergillus nidulans trpC gene" CDS complement(7115..7486) /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" promoter complement(7493..7853) /label=trpC promoter /note="promoter for Aspergillus nidulans trpC" promoter 7933..8933 /label=gpdA promoter /note="promoter from the Aspergillus nidulans glyceraldehyde-3-phosphate dehydrogenase gene (Punt et al., 1990)"
This page is informational only.