Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V003726 | pRK415 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pRK415
- Antibiotic Resistance:
- Tetracycline
- Length:
- 10690 bp
- Type:
- Broad host range expression vector
- Replication origin:
- oriV
- Source/Author:
- Hulter N, Wackernagel W.
- Promoter:
- lac
pRK415 vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pRK415 vector Sequence
LOCUS 40924_37123 10690 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range expression vector pRK415, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10690) AUTHORS Hulter N, Wackernagel W. TITLE Double illegitimate recombination events integrate DNA segments through two different mechanisms during natural transformation of Acinetobacter baylyi JOURNAL Mol. Microbiol. 67 (5), 984-995 (2008) PUBMED 18194157 REFERENCE 2 (bases 1 to 10690) AUTHORS Huelter N, Wackernagel W. TITLE Direct Submission JOURNAL Submitted (13-FEB-2007) Genetics, Department of Biology and Environmental Sciences, Carl von Ossietzky University Oldenburg, Carl-von-Ossietzkystrasse 9-11, Oldenburg 26111, Germany REFERENCE 3 (bases 1 to 10690) TITLE Direct Submission REFERENCE 4 (bases 1 to 10690) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Microbiol."; date: "2008"; volume: "67"; issue: "5"; pages: "984-995" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-FEB-2007) Genetics, Department of Biology and Environmental Sciences, Carl von Ossietzky University Oldenburg, Carl-von-Ossietzkystrasse 9-11, Oldenburg 26111, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10690 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(71..602) /direction=LEFT /label=oriV /note="incP origin of replication" misc_feature 1239..1295 /label=MCS /note="pUC18/19 multiple cloning site" promoter complement(1356..1386) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1401..1422) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(1657..2025) /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(2058..2167) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(2851..3498) /codon_start=1 /label=TetR /note="tetracycline resistance regulatory protein" /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD" CDS 3604..4800 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKPNIPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY GILLALYALVQFACAPVLGALSDRFGRRPILLVSLAGATVDYAIMATAPFLWVLYIGRI VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR " CDS complement(6077..7222) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" rep_origin complement(join(10071..10690,1..2)) /direction=LEFT /label=oriV /note="incP origin of replication"