Basic Vector Information
- Vector Name:
- pRIE
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5241 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Welch MD, Reed SC, Lamason RL, Serio AW.
pRIE vector Vector Map
pRIE vector Sequence
LOCUS 40924_37078 5241 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRIE, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5241) AUTHORS Welch MD, Reed SC, Lamason RL, Serio AW. TITLE Expression of an Epitope-Tagged Virulence Protein in Rickettsia parkeri Using Transposon Insertion JOURNAL PLoS ONE 7 (5), E37310 (2012) PUBMED 22624012 REFERENCE 2 (bases 1 to 5241) AUTHORS Reed SCO., Welch MD. TITLE Direct Submission JOURNAL Submitted (07-FEB-2012) Molecular and Cell Biology, University of California, Berkeley, 305 Life Sciences Addition, Berkeley, CA 94720-3200, USA REFERENCE 3 (bases 1 to 5241) TITLE Direct Submission REFERENCE 4 (bases 1 to 5241) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "5"; pages: "E37310" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-FEB-2012) Molecular and Cell Biology, University of California, Berkeley, 305 Life Sciences Addition, Berkeley, CA 94720-3200, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5241 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 112..133 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 148..178 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 186..202 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 210..226 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" regulatory 495..671 /label=flgBp /note="flgBp" /regulatory_class="promoter" CDS 672..1718 /codon_start=1 /product="Himar1" /label=Himar1 /note="Mariner transposase" /protein_id="AFJ44823.1" /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH IIHQYLDMRKLCAKWVPRELTFDQKQQRVDDSERCLQLLTRNTPEFFRRYVTMDETWLH HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIRELGFELLPHPPYSP DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYRNGIKKLEGRYNRCI ALEGNYVE" CDS 2092..2898 /label=KanR /note="aminoglycoside phosphotransferase" primer_bind complement(2986..3002) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" repeat_region 3143..3178 /label=ITR1 /note="ITR1" rep_origin complement(3279..3867) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 4076..4175 /label=MCS2 /note="MCS2" misc_feature complement(4408..4431) /label=MCS1 /note="MCS1" regulatory complement(4432..4572) /label=OmpAp /note="OmpAp" /regulatory_class="promoter" CDS complement(4591..5043) /codon_start=1 /product="Rparr-2" /label=Rparr-2 /note="rifampicin resistance protein" /protein_id="AFJ44822.1" /translation="MVKDWIPISHDNYKQVQGPFYHGTKANLAIGDLLTTGFISHFEDG RILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFEDDPNLTNKKFPGNPT QSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED" regulatory complement(5044..5204) /label=rpsLp /note="rpsLp" /regulatory_class="promoter"
This page is informational only.