Basic Vector Information
- Vector Name:
- pRGK335
- Length:
- 11051 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Engineer CB, Fitzsimmons KC, Schmuke JJ, Dotson SB, Kranz RG.
- Promoter:
- minimal CaMV 35S
pRGK335 vector Map
pRGK335 vector Sequence
LOCUS 40924_36963 11051 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pRGK335, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11051) AUTHORS Engineer CB, Fitzsimmons KC, Schmuke JJ, Dotson SB, Kranz RG. TITLE Development and evaluation of a Gal4-mediated LUC/GFP/GUS enhancer trap system in Arabidopsis JOURNAL BMC Plant Biol. 5, 9 (2005) PUBMED 15941484 REFERENCE 2 (bases 1 to 11051) AUTHORS Engineer CB, Fitzsimmons KC, Schmuke J, Dotson S, Kranz RG. TITLE Direct Submission JOURNAL Submitted (01-SEP-2004) Biology, Washington University in St. Louis, 1 Brookings Drive, Biology 1137, St. Louis, MO 63130-4899, USA REFERENCE 3 (bases 1 to 11051) TITLE Direct Submission REFERENCE 4 (bases 1 to 11051) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Plant Biol. 5, 9 (2005)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-SEP-2004) Biology, Washington University in St. Louis, 1 Brookings Drive, Biology 1137, St. Louis, MO 63130-4899, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11051 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(292..316) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" promoter 339..385 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" CDS 486..926 /codon_start=1 /label=GAL4 DNA binding domain /note="DNA binding domain of the GAL4 transcriptional activator" /translation="MKLLSSIEQACDICRLKKLKCSKKKPKCAKCLKNNWECRYSPKTK RSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNK DAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVS" CDS 930..1163 /codon_start=1 /label=VP16 AD /note="transcriptional activation domain of herpes simplex virus protein VP16 (Triezenberg et al., 1988; Cousens et al., 1989)" /translation="APPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGF TPHDSAPYGALDTADFEFEQMFTDALGIDEYGG" terminator 1170..1422 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" promoter 1670..1716 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" CDS 1829..2377 /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" protein_bind 2842..2936 /label=5X UAS /note="five tandem copies of the 'ScaI site' 17-mer CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) that efficiently binds yeast Gal4 (Webster et al., 1988; Pfeiffer et al., 2010)" misc_feature 2945..3041 /label=m35S /note="m35S" promoter 2997..3043 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" CDS 3081..4730 /codon_start=1 /label=luciferase /note="firefly luciferase" /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV" misc_feature 4776..5735 /label=TML /note="TML" protein_bind 5762..6032 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" promoter 6073..6119 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" misc_feature complement(6120..6144) /label=LB T-DNA repeat /note="left border repeat from octopine Ach5 T-DNA" rep_origin complement(6310..7023) /direction=LEFT /label=oriV /note="incP origin of replication" CDS 8291..8479 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 8584..8724 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(8910..9498) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 10071..10859 /codon_start=1 /product="spectinomycin/streptomycin resistance" /label=spectinomycin/streptomycin resistance /note="Spc/Str" /protein_id="AAY79159.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
This page is informational only.