Basic Vector Information
- Vector Name:
- pRGK 366
- Length:
- 11502 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Engineer CB, Kranz RG.
- Promoter:
- minimal CaMV 35S
pRGK 366 vector Map
pRGK 366 vector Sequence
LOCUS 40924_36953 11502 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pRGK 366, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 11502)
AUTHORS Engineer CB, Kranz RG.
TITLE Reciprocal leaf and root expression of AtAmt1.1 and root
architectural changes in response to nitrogen starvation
JOURNAL Plant Physiol. 143 (1), 236-250 (2007)
PUBMED 17085512
REFERENCE 2 (bases 1 to 11502)
AUTHORS Engineer CB, Kranz RG.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2006) Biology, Washington University in St. Louis,
1 Brookings Drive, # 1137, St. Louis, MO 63130, USA
REFERENCE 3 (bases 1 to 11502)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 11502)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant
Physiol."; date: "2007"; volume: "143"; issue: "1"; pages: "236-250"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-JUN-2006) Biology, Washington University in St. Louis, 1
Brookings Drive, # 1137, St. Louis, MO 63130, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..11502
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature complement(292..316)
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
primer_bind 587..603
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
primer_bind complement(700..716)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(724..740)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(748..778)
/label=lac promoter
/note="promoter for the E. coli lac operon"
promoter 790..836
/label=minimal CaMV 35S promoter
/note="minimal 35S promoter from cauliflower mosaic virus"
CDS 937..1377
/label=GAL4 DNA binding domain
/note="DNA binding domain of the GAL4 transcriptional
activator"
CDS 1381..1614
/label=VP16 AD
/note="transcriptional activation domain of herpes simplex
virus protein VP16 (Triezenberg et al., 1988; Cousens et
al., 1989)"
terminator 1621..1873
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
regulatory 1882..2283
/label=full 35S CaMV promoter
/note="full 35S CaMV promoter"
/regulatory_class="promoter"
promoter 2121..2167
/label=minimal CaMV 35S promoter
/note="minimal 35S promoter from cauliflower mosaic virus"
CDS 2280..2828
/label=BlpR
/note="phosphinothricin acetyltransferase"
misc_feature 2875..3247
/label=7S UTR
/note="7S UTR"
protein_bind 3293..3387
/label=5X UAS
/note="five tandem copies of the 'ScaI site' 17-mer
CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS)
that efficiently binds yeast Gal4 (Webster et al., 1988;
Pfeiffer et al., 2010)"
regulatory 3396..3492
/label=minimal 35S CaMV promoter element
/note="minimal 35S CaMV promoter element"
/regulatory_class="promoter"
promoter 3448..3494
/label=minimal CaMV 35S promoter
/note="minimal 35S promoter from cauliflower mosaic virus"
CDS 3532..5181
/label=luciferase
/note="firefly luciferase"
misc_feature 5227..6186
/label=TML cassette
/note="TML cassette"
protein_bind 6213..6483
/label=tetracycline response element
/note="contains seven copies of the tetracycline operator
tetO"
promoter 6524..6570
/label=minimal CaMV 35S promoter
/note="minimal 35S promoter from cauliflower mosaic virus"
misc_feature complement(6571..6595)
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
rep_origin complement(6761..7474)
/direction=LEFT
/label=oriV
/note="incP origin of replication"
CDS 8742..8930
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
misc_feature 9035..9175
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(9361..9949)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
gene 10522..11311
/gene="spc/str"
/label=spc/str
CDS 10522..11310
/codon_start=1
/gene="spc/str"
/product="spectinomycin/streptomycin resistance"
/label=spc/str
/protein_id="ABG75722.1"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
This page is informational only.