Basic Vector Information
- Vector Name:
- PRFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3469 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zhang J.
PRFP vector Map
PRFP vector Sequence
LOCUS 40924_36923 3469 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector PRFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3469) AUTHORS Zhang J. TITLE Direct Submission JOURNAL Submitted (17-AUG-2016) Research Institute of Pomology, Chinese Academy of Agricultural Sciences, Xingcheng, Liaoning 125100, China REFERENCE 2 (bases 1 to 3469) TITLE Direct Submission REFERENCE 3 (bases 1 to 3469) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (17-AUG-2016) Research Institute of Pomology, Chinese Academy of Agricultural Sciences, Xingcheng, Liaoning 125100, China" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3469 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 415..433 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 491..1177 /codon_start=1 /label=TagRFP /note="monomeric derivative of red fluorescent protein from Entacmaea quadricolor (Merzlyak et al., 2007)" /translation="ELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVE GGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQ DTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALKLV GGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDL PSKLGHK" primer_bind complement(1248..1264) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1272..1288) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1296..1326) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1341..1362) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1650..2238) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2412..3269) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQAQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFLADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAAIGAS LIKHW" promoter complement(3270..3374) /label=AmpR promoter
This page is informational only.