Basic Vector Information
- Vector Name:
- pRetroES
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6293 bp
- Type:
- Retrofitting vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Wang Z, Engler P, Longacre A, Storb U.
- Promoter:
- mPGK
pRetroES vector Map
pRetroES vector Sequence
LOCUS 40924_36793 6293 bp DNA circular SYN 18-DEC-2018 DEFINITION Retrofitting vector pRetroES, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6293) AUTHORS Wang Z, Engler P, Longacre A, Storb U. TITLE An efficient method for high-fidelity BAC/PAC retrofitting with a selectable marker for mammalian cell transfection JOURNAL Genome Res. 11 (1), 137-142 (2001) PUBMED 11156622 REFERENCE 2 (bases 1 to 6293) AUTHORS Wang Z, Engler P, Longacre A, Storb U. TITLE Direct Submission JOURNAL Submitted (05-JUL-2001) Mol. Genet. Cell Biol., University of Chicago, 920 E. 58th St., Chicago, IL 60637, USA REFERENCE 3 (bases 1 to 6293) TITLE Direct Submission REFERENCE 4 (bases 1 to 6293) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genome Res."; date: "2001"; volume: "11"; issue: "1"; pages: "137-142" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-JUL-2001) Mol. Genet. Cell Biol., University of Chicago, 920 E. 58th St., Chicago, IL 60637, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6293 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 470..498 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 506..522 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 561..1205 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MLGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFEL GLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVS RIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMD PMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 1212..1229 /codon_start=1 /label=thrombin site /note="thrombin recognition and cleavage site" /translation="LVPRGS" protein_bind complement(1266..1299) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." CDS 1332..2360 /codon_start=1 /label=Cre /note="site-specific recombinase" /translation="MANLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL PRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAF LGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVE RWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQ RYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLE DGD" terminator 2463..2510 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" polyA_signal complement(2587..3048) /label=PGK poly(A) signal /note="mouse phosphoglycerate kinase 1 polyadenylation signal" CDS complement(3067..3867) /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="MGSAIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQ GRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQD LLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDE EHQGLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQ DIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" promoter complement(3881..4377) /label=PGK promoter /note="mouse phosphoglycerate kinase 1 promoter" rep_origin 4509..4897 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(5035..5892) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(5893..5997) /label=AmpR promoter primer_bind 6218..6234 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.