Basic Vector Information
- Vector Name:
- pRED56-MD8-Pnos-14
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8138 bp
- Type:
- Gateway recycling vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Saisho T, Shibahara K, Nakao A, Tanaka Y, Nishimura K, Kimura T, Nakagawa T.
- Promoter:
- NOS
pRED56-MD8-Pnos-14 vector Map
pRED56-MD8-Pnos-14 vector Sequence
LOCUS 40924_36613 8138 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway recycling vector pRED56-MD8-Pnos-14 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8138) AUTHORS Saisho T, Shibahara K, Nakao A, Tanaka Y, Nishimura K, Kimura T, Nakagawa T. TITLE Improved Gateway Recycling Cloning System for Multigene Construction JOURNAL Unpublished REFERENCE 2 (bases 1 to 8138) AUTHORS Saisho T, Shibahara K, Nakao A, Tanaka Y, Nishimura K, Kimura T, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (02-NOV-2015) Contact:Tsuyoshi Nakagawa Shimane University, Interdisciplinary Center for Science Research; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan REFERENCE 3 (bases 1 to 8138) TITLE Direct Submission REFERENCE 4 (bases 1 to 8138) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-NOV-2015) Contact:Tsuyoshi Nakagawa Shimane University, Interdisciplinary Center for Science Research; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pDONR201. FEATURES Location/Qualifiers source 1..8138 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 28..127 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" misc_feature 674..1071 /label=MD8 /note="MD8" promoter 1192..1375 /label=NOS promoter /note="nopaline synthase promoter" protein_bind 1394..1518 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1555..1585 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1639..2295 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2640..2942 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2986..3110) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 3139..3228 /codon_start=1 /label=3xHA /note="three tandem HA epitope tags" /translation="YPYDVPDYAGYPYDVPDYAGSYPYDVPDYA" terminator 3262..3514 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" protein_bind 3723..3847 /label=attR4 /note="recombination site for the Gateway(R) LR reaction" promoter 3872..3902 /label=lac UV5 promoter /note="E. coli lac promoter with an ""up"" mutation" misc_feature 4174..4214 /label=rare cutter sites /note="rare cutter sites" CDS complement(4306..5163) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(5164..5268) /label=AmpR promoter protein_bind complement(5565..5688) /label=attR3 /note="recombination site for the Gateway(R) LR reaction" protein_bind complement(6014..6109) /label=attL6 /note="recombination site for the Gateway(R) LR reaction" CDS 6233..7039 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 7185..7773 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(7908..7935) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(8027..8113) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.