Basic Vector Information
- Vector Name:
- pRAN334
- Antibiotic Resistance:
- Tetracycline
- Length:
- 7922 bp
- Type:
- Clostridium difficile shuttle vector
- Replication origin:
- ori
- Source/Author:
- Ransom EM, Williams KB, Weiss DS, Ellermeier CD.
pRAN334 vector Vector Map
pRAN334 vector Sequence
LOCUS V003828 7922 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003828 VERSION V003828 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7922) AUTHORS Ransom EM, Williams KB, Weiss DS, Ellermeier CD. TITLE Identification and characterization of a gene cluster required for proper rod shape, cell division, and pathogenesis in Clostridium difficile JOURNAL J. Bacteriol. 196 (12), 2290-2300 (2014) PUBMED 24727226 REFERENCE 2 (bases 1 to 7922) AUTHORS Ransom EM, Weiss DS, Ellermeier CD. TITLE Direct Submission JOURNAL Submitted (06-AUG-2015) Microbiology, The University of Iowa, 51 Newton Rd, Iowa City, IA 52242, USA REFERENCE 3 (bases 1 to 7922) TITLE Direct Submission REFERENCE 4 (bases 1 to 7922) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "J. Bacteriol."; date: "2014"; volume: "196"; issue: "12"; pages: "2290-2300" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-AUG-2015) Microbiology, The University of Iowa, 51 Newton Rd, Iowa City, IA 52242, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7922 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(58..681) /label="TetR" /note="tetracycline repressor TetR" protein_bind 788..806 /label="tet operator" /note="bacterial operator O1 for the tetR and tetA genes" CDS 873..1589 /label="ECFP" /note="enhanced CFP" CDS complement(1941..2309) /label="traJ" /note="oriT-recognizing protein" oriT complement(2342..2451) /direction=LEFT /label="oriT" /note="incP origin of transfer" CDS complement(2830..3450) /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" rep_origin complement(3813..4401) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5194..6831) /codon_start=1 /gene="repA" /product="RepA" /label="repA" /note="plasmid replication; derived from Clostridium difficile" /protein_id="AMA07794.1" /translation="MEQLDSKYKLKKFLMAVFRDGIGQGNNLIDNEYVRVFQNNKSNSK QLELGEEFKEYSKTTFFKNIDDIVEFTFAKNIYYENTFFNLCTTDGKAGTNENLINRYA LGFDFDKKELGQGFNYKDIINLFTKIGLHYHILVDSGNGFHVYVLINKTNNIKLVSEVT NTLINKLGADKQANLSTQVLRVPYTYNIKNTTKQVKIIHQDKNIYRYDIEKLAKKYCKD VKTVGNTNTKYILDSKLPNCIVDILKNGSKDGHKNLDLQKIVVTLRLRNKSLSQVISVA REWNYISQNSLSNSELEYQVKYMYEKLKTVNFGCTGCEFNSDCWNKIESDFIYSDEDTL FNMPHKHSKDLKYKNRKGVKIMTGNQLFIYNVLLNNKDRELNIDDIMELITYKRKKKVK NIVMSEKTLRETLKELQHNDYITKTKGVTKLGIKDTYNVKEVRCNIDKQYTISYFVTMA VIWGIISTEELRLYTHMRYKQDLLVKDDKIKGNILRINQEELAKDLGVTQQRISNMIES LLDTKILDVWETKINDRGFMYYTYRLNK" gene complement(5194..6831) /gene="repA" /label="repA" CDS complement(7106..7618) /codon_start=1 /gene="orfB" /product="OrfB" /label="orfB" /protein_id="AMA07792.1" /translation="MRARSSKWRYHIRTNNKSICCNIKNFIHNLELFYKMELKLSDNII NDKLYYSNIAEFEEFETLEKAREVESTIISQYQFLDSINHMLKQKIILLSNKDSVLNIT KNGNTNYLKVKNKYIEKHKNKPIMRYHINCQFNTDGSVKSITQEFEPILELNKKNTLSR PSRVFLK" gene complement(7106..7618) /gene="orfB" /label="orfB"
This page is informational only.