Basic Vector Information
- Vector Name:
- pQUAST
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8950 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Potter CJ, Tasic B, Russler EV, Liang L, Luo L.
- Promoter:
- hsp70
pQUAST vector Vector Map
pQUAST vector Sequence
LOCUS 40924_36268 8950 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pQUAST, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8950) AUTHORS Potter CJ, Tasic B, Russler EV, Liang L, Luo L. TITLE The Q system: a repressible binary system for transgene expression, lineage tracing, and mosaic analysis JOURNAL Cell 141 (3), 536-548 (2010) PUBMED 20434990 REFERENCE 2 (bases 1 to 8950) AUTHORS Potter CJ, Tasic B, Luo L. TITLE Direct Submission JOURNAL Submitted (08-APR-2010) Neuroscience, The Johns Hopkins School of Medicine, 855 N. Wolfe Street, Baltimore, MD 21205, USA REFERENCE 3 (bases 1 to 8950) TITLE Direct Submission REFERENCE 4 (bases 1 to 8950) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell"; date: "2010"; volume: "141"; issue: "3"; pages: "536-548" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-APR-2010) Neuroscience, The Johns Hopkins School of Medicine, 855 N. Wolfe Street, Baltimore, MD 21205, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8950 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(235..823) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(997..1854) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(1855..1959) /label=AmpR promoter misc_feature complement(2761..2993) /label=P element 3' end /note="P element 3' end" misc_feature 3047..3140 /label=5XQUAS /note="5XQUAS" promoter 3189..3427 /label=hsp70 promoter /note="Drosophila melanogaster hsp70Bb promoter" misc_feature 3441..3511 /label=multi-cloning site /note="multi-cloning site" intron 3588..3653 /label=small t intron /note="SV40 (simian virus 40) small t antigen intron" CDS 3783..3803 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" polyA_signal 4075..4209 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" gene 4227..8354 /label=mini-white /note="This modified version of the white gene lacks part of the first intron." misc_feature complement(8365..8950) /label=P element 5' end
This page is informational only.