Basic Vector Information
- Vector Name:
- pQLICE
- Length:
- 10546 bp
- Type:
- Broad-host-range expression vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Harms K, Schon V, Kickstein E, Wackernagel W.
pQLICE vector Vector Map
pQLICE vector Sequence
LOCUS 40924_36203 10546 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad-host-range expression vector pQLICE, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10546) AUTHORS Harms K, Schon V, Kickstein E, Wackernagel W. TITLE The RecJ DNase strongly suppresses genomic integration of short but not long foreign DNA fragments by homology-facilitated illegitimate recombination during transformation of Acinetobacter baylyi JOURNAL Mol. Microbiol. 64 (3), 691-702 (2007) PUBMED 17462017 REFERENCE 2 (bases 1 to 10546) AUTHORS Kickstein E, Harms K, Wackernagel W. TITLE Deletions of recBCD or recD influence genetic transformation differently and are lethal together with a recJ deletion in Acinetobacter baylyi JOURNAL Microbiology (Reading, Engl.) 153 (PT 7), 2259-2270 (2007) PUBMED 17600070 REFERENCE 3 (bases 1 to 10546) AUTHORS Huelter N. TITLE Direct Submission JOURNAL Submitted (15-DEC-2006) Genetics, Department of Biology and Environmental Sciences, Carl von Ossietzky University of Oldenburg, Carl-von-Ossietzky-Strasse 9-11, Oldenburg D-26111, Germany REFERENCE 4 (bases 1 to 10546) TITLE Direct Submission REFERENCE 5 (bases 1 to 10546) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Microbiol."; date: "2007"; volume: "64"; issue: "3"; pages: "691-702" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Microbiology (Reading, Engl.) 153 (PT 7), 2259-2270 (2007)" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (15-DEC-2006) Genetics, Department of Biology and Environmental Sciences, Carl von Ossietzky University of Oldenburg, Carl-von-Ossietzky-Strasse 9-11, Oldenburg D-26111, Germany" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..10546 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 63..866 /codon_start=1 /gene="strA" /product="streptomycin resistance protein A" /label=strA /protein_id="ABM30607.1" /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRR GELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPS MGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPLHDLLARV ERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIA NAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG" gene 63..866 /gene="strA" /label=strA CDS 866..1702 /codon_start=1 /gene="strB" /product="streptomycin resistance protein B" /label=strB /protein_id="ABM30608.1" /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKP IEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIA AELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNA SELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIA QMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQTSY" gene 866..1702 /gene="strB" /label=strB misc_feature 1674..2034 /note="fragment; similar to transposase" misc_feature 2035..2050 /label=multiple cloning site /note="multiple cloning site" protein_bind complement(2065..2099) /label=LacI repressor protein binding site /bound_moiety="LacI repressor protein" /note="lac operator" protein_bind 2074..2090 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2098..2126) /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" promoter 2360..2437 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 2438..3517 /label=lacI /note="lac repressor" misc_feature 3897..4075 /note="fragment; similar to transposase" rep_origin complement(4208..4602) /direction=LEFT /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" CDS complement(4629..4913) /codon_start=1 /gene="mobC" /product="mobilization protein C" /label=mobC /protein_id="ABM30610.1" /translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRK VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG" gene complement(4629..4913) /gene="mobC" /label=mobC oriT 4944..5031 /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 5860..6273 /codon_start=1 /gene="mobB" /product="mobilization protein B" /label=mobB /protein_id="ABM30612.1" /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQAS EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR" gene 5860..6273 /gene="mobB" /label=mobB CDS 6270..7238 /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 7302..7514 /codon_start=1 /gene="E" /product="hypothetical protein" /label=E /note="unknown protein E" /protein_id="ABM30614.1" /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS LNLDGCTLSLFREDKPFGPGKFLGD" gene 7302..7514 /gene="E" /label=E CDS 7516..7722 /codon_start=1 /gene="F" /product="repressor protein F" /label=F /note="regulates repAC operon" /protein_id="ABM30615.1" /translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY EALRECLEELRAAQGGGSDPASA" gene 7516..7722 /gene="F" /label=F misc_RNA 7685..7759 /product="regulatory RNA" regulatory 7739..7745 /gene="repA" /regulatory_class="ribosome_binding_site" CDS 7752..8588 /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 8578..9426 /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 9737..10525 /codon_start=1 /gene="sulII" /product="sulfonamid resistance protein" /label=sulII /protein_id="ABM30618.1" /translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVI DLVRHPAIPTPRLFRPTQKSRVCAGAGRAQADGIPVSLDSYQPATQAYALSRGVAYLND IRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGA GIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRG PGVSGPRHSLQSLPPPQVELTSSAHTSRAPCATGWRYWRR" gene 9737..10525 /gene="sulII" /label=sulII
This page is informational only.