Basic Vector Information
- Vector Name:
- pP{wlo-hsinGS}
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10973 bp
- Type:
- P-element cloning system vector
- Replication origin:
- ori
- Source/Author:
- Roman G, Endo K, Zong L, Davis RL.
- Promoter:
- hsp70
pP{wlo-hsinGS} vector Map
pP{wlo-hsinGS} vector Sequence
LOCUS 40924_35888 10973 bp DNA circular SYN 18-DEC-2018 DEFINITION P-element cloning system vector pP{wlo-hsinGS}, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10973) AUTHORS Roman G, Endo K, Zong L, Davis RL. TITLE P[Switch], a system for spatial and temporal control of gene expression in Drosophila melanogaster JOURNAL Proc. Natl. Acad. Sci. U.S.A. 98 (22), 12602-12607 (2001) PUBMED 11675496 REFERENCE 2 (bases 1 to 10973) AUTHORS Roman G, Davis RL. TITLE Conditional expression of UAS-transgenes in the adult eye with a new gene-switch vector system JOURNAL Genesis 34 (1-2), 127-131 (2002) PUBMED 12324966 REFERENCE 3 (bases 1 to 10973) AUTHORS Roman G, Davis RL. TITLE Direct Submission JOURNAL Submitted (25-JUN-2002) Molecular and Cellular Biology, Baylor College of Medicine, One Baylor Plaza, Houston, TX 77030, USA REFERENCE 4 (bases 1 to 10973) TITLE Direct Submission REFERENCE 5 (bases 1 to 10973) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2001"; volume: "98"; issue: "22"; pages: "12602-12607" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Genesis 34 (1-2), 127-131 (2002)" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (25-JUN-2002) Molecular and Cellular Biology, Baylor College of Medicine, One Baylor Plaza, Houston, TX 77030, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..10973 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..586 /label=P element 5' end CDS complement(join(1364..1978,2049..2180,2401..2716,2778..3432, 3507..3780,4175..4246)) /codon_start=1 /gene="mini-white" /product="white" /label=mini-white /protein_id="AAM82584.1" /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE" gene complement(1364..4246) /gene="mini-white" /label=mini-white protein_bind 4738..4771 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." promoter 4782..5019 /label=hsp70 promoter /note="Drosophila melanogaster hsp70Bb promoter" intron 5053..5110 /note="from P transposase first intron" CDS 6717..7088 /label=RelA (p65) AD /note="transcriptional activation domain of human RelA, also known as p65 (O'Shea and Perkins, 2008)" misc_feature 7700..7938 /label=HSP70 termination sequence /note="HSP70 termination sequence" primer_bind complement(7940..7956) /label=SK primer /note="common sequencing primer, one of multiple similar variants" misc_feature 7981..8213 /label=P element 3' end /note="P element 3' end" misc_feature 8214..8714 /label=white linker sequence /note="white linker sequence" promoter 9015..9119 /label=AmpR promoter CDS 9120..9977 /label=AmpR /note="beta-lactamase" rep_origin 10151..10739 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 10745..10973 /label=white linker sequence /note="white linker sequence"
This page is informational only.