pP{CaSpeR4-lo-} vector (V003872)

Basic Vector Information

Vector Name:
pP{CaSpeR4-lo-}
Antibiotic Resistance:
Ampicillin
Length:
7857 bp
Type:
P-element cloning system vector
Replication origin:
ori
Source/Author:
Roman G, Endo K, Zong L, Davis RL.

pP{CaSpeR4-lo-} vector Map

pP{CaSpeR4-lo-}7857 bp30060090012001500180021002400270030003300360039004200450048005100540057006000630066006900720075007800P element 5' endmini-whiteloxPP element 3' endwhite linker sequenceAmpR promoterAmpRoriwhite linker sequence

pP{CaSpeR4-lo-} vector Sequence

LOCUS       40924_35863        7857 bp DNA     circular SYN 18-DEC-2018
DEFINITION  P-element cloning system vector pP{CaSpeR4-lo-}, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7857)
  AUTHORS   Roman G, Endo K, Zong L, Davis RL.
  TITLE     P[Switch], a system for spatial and temporal control of gene 
            expression in Drosophila melanogaster
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98 (22), 12602-12607 (2001)
  PUBMED    11675496
REFERENCE   2  (bases 1 to 7857)
  AUTHORS   Roman G, Davis RL.
  TITLE     Conditional expression of UAS-transgenes in the adult eye with a new
            gene-switch vector system
  JOURNAL   Genesis 34 (1-2), 127-131 (2002)
  PUBMED    12324966
REFERENCE   3  (bases 1 to 7857)
  AUTHORS   Roman G, Davis RL.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2002) Molecular and Cellular Biology, Baylor 
            College of Medicine, One Baylor Plaza, Houston, TX 77030, USA
REFERENCE   4  (bases 1 to 7857)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 7857)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "2001"; volume: "98"; issue: "22"; pages: 
            "12602-12607"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Genesis 34 
            (1-2), 127-131 (2002)"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (25-JUN-2002) Molecular and Cellular Biology, Baylor College of 
            Medicine, One Baylor Plaza, Houston, TX 77030, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7857
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..586
                     /label=P element 5' end
     gene            complement(597..4733)
                     /label=mini-white
                     /note="This modified version of the white gene lacks part
                     of the first intron."
     protein_bind    4738..4771
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     misc_feature    4865..5097
                     /label=P element 3' end
                     /note="P element 3' end"
     misc_feature    5098..5598
                     /label=white linker sequence
                     /note="white linker sequence"
     promoter        5899..6003
                     /label=AmpR promoter
     CDS             6004..6861
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      7035..7623
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    7629..7857
                     /label=white linker sequence
                     /note="white linker sequence"

This page is informational only.