Basic Vector Information
- Vector Name:
- pP{CaSpeR4-lo-}
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7857 bp
- Type:
- P-element cloning system vector
- Replication origin:
- ori
- Source/Author:
- Roman G, Endo K, Zong L, Davis RL.
pP{CaSpeR4-lo-} vector Map
pP{CaSpeR4-lo-} vector Sequence
LOCUS 40924_35863 7857 bp DNA circular SYN 18-DEC-2018 DEFINITION P-element cloning system vector pP{CaSpeR4-lo-}, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7857) AUTHORS Roman G, Endo K, Zong L, Davis RL. TITLE P[Switch], a system for spatial and temporal control of gene expression in Drosophila melanogaster JOURNAL Proc. Natl. Acad. Sci. U.S.A. 98 (22), 12602-12607 (2001) PUBMED 11675496 REFERENCE 2 (bases 1 to 7857) AUTHORS Roman G, Davis RL. TITLE Conditional expression of UAS-transgenes in the adult eye with a new gene-switch vector system JOURNAL Genesis 34 (1-2), 127-131 (2002) PUBMED 12324966 REFERENCE 3 (bases 1 to 7857) AUTHORS Roman G, Davis RL. TITLE Direct Submission JOURNAL Submitted (25-JUN-2002) Molecular and Cellular Biology, Baylor College of Medicine, One Baylor Plaza, Houston, TX 77030, USA REFERENCE 4 (bases 1 to 7857) TITLE Direct Submission REFERENCE 5 (bases 1 to 7857) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2001"; volume: "98"; issue: "22"; pages: "12602-12607" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Genesis 34 (1-2), 127-131 (2002)" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (25-JUN-2002) Molecular and Cellular Biology, Baylor College of Medicine, One Baylor Plaza, Houston, TX 77030, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..7857 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..586 /label=P element 5' end gene complement(597..4733) /label=mini-white /note="This modified version of the white gene lacks part of the first intron." protein_bind 4738..4771 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." misc_feature 4865..5097 /label=P element 3' end /note="P element 3' end" misc_feature 5098..5598 /label=white linker sequence /note="white linker sequence" promoter 5899..6003 /label=AmpR promoter CDS 6004..6861 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 7035..7623 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 7629..7857 /label=white linker sequence /note="white linker sequence"
This page is informational only.