Basic Vector Information
- Vector Name:
- pPYPX99
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9139 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Yao Q, Peng R, Xiong A.
- Promoter:
- AOX1
pPYPX99 vector Map
pPYPX99 vector Sequence
LOCUS 40924_35743 9139 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pPYPX99, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9139) AUTHORS Yao Q, Peng R, Xiong A. TITLE Direct Submission JOURNAL Submitted (12-NOV-2002) Shanghai Academy of Agricultural Sciences, Agro-Biotechnology Research Center, 2901 Beidi Rd, Shanghai 201106, China REFERENCE 2 (bases 1 to 9139) TITLE Direct Submission REFERENCE 3 (bases 1 to 9139) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (12-NOV-2002) Shanghai Academy of Agricultural Sciences, Agro-Biotechnology Research Center, 2901 Beidi Rd, Shanghai 201106, China" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT NCBI staff are still waiting for submitters to provide appropriate coding region information. FEATURES Location/Qualifiers source 1..9139 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..936 /label=modified AOX1 promoter /note="modified AOX1 promoter" misc_feature 937..1212 /label=similar to modified alpha factor secretion signal /note="similar to modified alpha factor secretion signal" terminator 1343..1589 /label=AOX1 terminator /note="transcription terminator for AOX1" misc_feature complement(1994..4527) /label=similar to phosphoribosyl-ATP pyrophosphohydrolase /note="similar to phosphoribosyl-ATP pyrophosphohydrolase" CDS 4798..5610 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" misc_feature 5985..6741 /label=AOX1 3' fragment /note="region downstream of Pichia pastoris AOX1 gene" misc_feature 6884..7024 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7210..7798) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7972..8829) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(8830..8934) /label=AmpR promoter promoter 9139 /label=AOX1 promoter /note="inducible promoter, regulated by methanol"
This page is informational only.