Basic Vector Information
- Vector Name:
- pPxylA-cel8A
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8084 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P.
pPxylA-cel8A vector Map
pPxylA-cel8A vector Sequence
LOCUS 40924_35723 8084 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pPxylA-cel8A, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8084) AUTHORS Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P. TITLE Efficient secretory heterologous enzyme production in the novel host Paenibacillus polymyxa by usage of its promoter sequences JOURNAL Unpublished REFERENCE 2 (bases 1 to 8084) AUTHORS Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P. TITLE Direct Submission JOURNAL Submitted (09-MAY-2018) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany REFERENCE 3 (bases 1 to 8084) TITLE Direct Submission REFERENCE 4 (bases 1 to 8084) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-MAY-2018) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8084 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(79..667) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(841..1698) /label=AmpR /note="beta-lactamase" promoter complement(1699..1803) /label=AmpR promoter CDS complement(1832..2116) /codon_start=1 /gene="traJ" /product="TraJ" /label=traJ /protein_id="AXF54483.1" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGQQKAHYVNHHPNQVFWGRGAVKH" gene complement(1832..2116) /gene="traJ" /label=traJ oriT complement(2149..2258) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(2515..3276) /codon_start=1 /gene="kanR" /product="KanR" /label=kanR /note="Kanamycin Resistance" /protein_id="AXF54484.1" /translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK LLESLENFWNGIQEWTERHGYIVDVSKRIPF" gene complement(2515..3276) /gene="kanR" /label=kanR CDS complement(3448..4449) /label=repB /note="RepB replication protein" CDS complement(5063..6229) /codon_start=1 /gene="xylR" /product="XylR" /label=xylR /note="XylR from B. megaterium xyl-operon" /protein_id="AXF54485.1" /translation="MVIIQIADQALVKKMNQKLILDEILKNSPVSRATLSEITGLNKST VSSQVNTLLEKDFIFEIGAGQSRGGRRPVMLVFNKNAGYSIGIDIGVDYLNGILTDLEG NIILEKTSDLSSSSASEVKEILFALIHGFVTHMPESPYGLVGIGICVPGLVDRHQQIIF MPNLNWNIKDLQFLIESEFNVPVFVENEANAGAYGEKVFGMTKNYENIVYISINIGIGT GLVINNELYKGVQGFSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLASLSKEEKNI SRKEIVERANKNDVEMLNALQNFGFYIGIGLTNILNTFDIEAVILRNHIIESHPIVLNT IKNEVSSRVHSHLDNKCELLPSSLGKNAPALGAVSIVIDSFLSVTPIS" gene complement(5063..6229) /gene="xylR" /label=xylR regulatory 6333..6367 /note="PxylA, xylose inducible promoter, derived from pHIS1525" /regulatory_class="promoter" misc_feature 6369..6397 /label=XylR binding site /note="XylR binding site" CDS 6461..6544 /codon_start=1 /gene="SPLipB-Cel8A-His6" /product="LipB signal peptide" /label=SPLipB-Cel8A-His6 /protein_id="AXF54486.1" /translation="MKKVLMAFIICLSLILSVLAAPPSGAKA" CDS 7904..7921 /label=6xHis /note="6xHis affinity tag"
This page is informational only.