Basic Vector Information
- Vector Name:
- pPVLUC441
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6320 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hashinaka K.
pPVLUC441 vector Vector Map
pPVLUC441 vector Sequence
LOCUS 40924_35703 6320 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPVLUC441 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6320) AUTHORS Hashinaka K. TITLE Synthetic Autonomous Vectors Based on Palindromic Sequences of Parvovirus B19 JOURNAL Published Only in Database (2001) REFERENCE 2 (bases 1 to 6320) AUTHORS Hashinaka K. TITLE Direct Submission JOURNAL Submitted (21-FEB-2000) Kazuya Hashinaka, Miyazaki Medical College, Department of Biochemistry; 5200 Kihara, Kiyotake, Miyazaki 889-1692, Japan (E-mail:hasinaka@post1.miyazaki-med.ac.jp, Tel:81-985-85-0985, Fax:81-985-85-2401) REFERENCE 3 (bases 1 to 6320) TITLE Direct Submission REFERENCE 4 (bases 1 to 6320) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Published Only in Database (2001)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-FEB-2000) Kazuya Hashinaka, Miyazaki Medical College, Department of Biochemistry"; volume: " 5200 Kihara, Kiyotake, Miyazaki 889-1692, Japan (E-mail:hasinaka@post1.miyazaki-med.ac.jp, Tel:81-985-85-0985, Fax"; pages: "81-985-85-2401" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6320 /mol_type="other DNA" /organism="synthetic DNA construct" source 6..479 /mol_type="other DNA" /label=synonym:Parvovirus B19 /note="synonym:Parvovirus B19" /db_xref="taxon:10798" /organism="Human parvovirus B19" source 2937..3420 /mol_type="other DNA" /label=synonym:Parvovirus B19 /note="synonym:Parvovirus B19" /db_xref="taxon:10798" /organism="Human parvovirus B19" repeat_region 9..391 promoter 522..720 /label=SV40 promoter /note="SV40 early promoter" regulatory 750..759 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" CDS 1347..2414 /codon_start=1 /gene="luc" /product="luciferase" /label=luc /protein_id="BAB32737.1" /translation="MNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSV VPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKST LIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDK PGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGW LHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDD AGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKI REILIKAKKGGKIAV" gene 1347..2414 /gene="luc" /label=luc polyA_signal complement(2455..2576) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" repeat_region 3029..3411 promoter complement(3429..3447) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3454..3470) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 3611..4066 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4147..4251 /label=AmpR promoter CDS 4252..5109 /label=AmpR /note="beta-lactamase" rep_origin 5283..5871 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 6159..6180 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6195..6225 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6233..6249 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6257..6273 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 6291..6309 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.