pPVLUC441 vector (V003890)

LOCUS       40924_35703        6320 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPVLUC441 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6320)
  AUTHORS   Hashinaka K.
  TITLE     Synthetic Autonomous Vectors Based on Palindromic Sequences of 
            Parvovirus B19
  JOURNAL   Published Only in Database (2001)
REFERENCE   2  (bases 1 to 6320)
  AUTHORS   Hashinaka K.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2000) Kazuya Hashinaka, Miyazaki Medical College, 
            Department of Biochemistry; 5200 Kihara, Kiyotake, Miyazaki 
            889-1692, Japan (E-mail:hasinaka@post1.miyazaki-med.ac.jp, 
            Tel:81-985-85-0985, Fax:81-985-85-2401)
REFERENCE   3  (bases 1 to 6320)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6320)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Published 
            Only in Database (2001)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-FEB-2000) Kazuya Hashinaka, Miyazaki Medical College, Department
            of Biochemistry"; volume: " 5200 Kihara, Kiyotake, Miyazaki 
            889-1692, Japan (E-mail:hasinaka@post1.miyazaki-med.ac.jp, 
            Tel:81-985-85-0985, Fax"; pages: "81-985-85-2401"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6320
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          6..479
                     /mol_type="other DNA"
                     /label=synonym:Parvovirus B19
                     /note="synonym:Parvovirus B19"
                     /db_xref="taxon:10798"
                     /organism="Human parvovirus B19"
     source          2937..3420
                     /mol_type="other DNA"
                     /label=synonym:Parvovirus B19
                     /note="synonym:Parvovirus B19"
                     /db_xref="taxon:10798"
                     /organism="Human parvovirus B19"
     repeat_region   9..391
     promoter        522..720
                     /label=SV40 promoter
                     /note="SV40 early promoter"
     regulatory      750..759
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             1347..2414
                     /codon_start=1
                     /gene="luc"
                     /product="luciferase"
                     /label=luc
                     /protein_id="BAB32737.1"
                     /translation="MNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSV
                     VPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKST
                     LIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDK
                     PGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGW
                     LHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDD
                     AGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKI
                     REILIKAKKGGKIAV"
     gene            1347..2414
                     /gene="luc"
                     /label=luc
     polyA_signal    complement(2455..2576)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     repeat_region   3029..3411
     promoter        complement(3429..3447)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3454..3470)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      3611..4066
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4147..4251
                     /label=AmpR promoter
     CDS             4252..5109
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      5283..5871
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    6159..6180
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        6195..6225
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    6233..6249
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     6257..6273
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        6291..6309
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"