Basic Vector Information
- Vector Name:
- pPV529
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6638 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Shao H, Li X, Lok JB.
pPV529 vector Vector Map
pPV529 vector Sequence
LOCUS 40924_35683 6638 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPV529, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6638) AUTHORS Shao H, Li X, Lok JB. TITLE Heritable genetic transformation of Strongyloides stercoralis by microinjection of plasmid DNA constructs into the male germline JOURNAL Int. J. Parasitol. (2017) In press PUBMED 28577882 REFERENCE 2 (bases 1 to 6638) AUTHORS Shao H, Li X, Lok JB. TITLE Direct Submission JOURNAL Submitted (28-MAR-2017) Pathobiology, University of Pennsylvania, 3800 Spruce Street, Rosenthal 212, Philadelphia, PA 19104, USA REFERENCE 3 (bases 1 to 6638) TITLE Direct Submission REFERENCE 4 (bases 1 to 6638) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Int. J. Parasitol. (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-MAR-2017) Pathobiology, University of Pennsylvania, 3800 Spruce Street, Rosenthal 212, Philadelphia, PA 19104, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6638 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 27..131 /label=AmpR promoter CDS 132..989 /label=AmpR /note="beta-lactamase" rep_origin 1163..1751 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2039..2060 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2075..2105 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2113..2129 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2137..2153 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" mobile_element 2644..2678 /mobile_element_type="transposon:PiggyBac ITR" /label=ITR regulatory 2954..4116 /regulatory_class="promoter" CDS join(4129..4299,4351..4504,4556..4719,4771..4998) /codon_start=1 /gene="gfp" /product="green fluorescent protein" /label=gfp /note="GFP" /protein_id="ARW80044.1" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" gene 4129..4998 /gene="gfp" /label=gfp 3'UTR 5018..5604 /gene="Ss era-1" gene 5018..5604 /gene="Ss era-1" /label=Ss era-1 primer_bind 5618..5634 /label=SK primer /note="common sequencing primer, one of multiple similar variants" mobile_element 5831..5893 /mobile_element_type="transposon:PiggyBac ITR" /label=ITR primer_bind complement(6023..6039) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 6181..6636 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.