pPV254 vector (V003900)

Download GeneBank File(.gb)

LOCUS       40924_35658        6758 bp DNA     circular SYN 18-DEC-2018
DEFINITION  PiggyBac_based_Ss_Act2_gfp_era1 vector pPV254, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6758)
  AUTHORS   Shao H, Li X, Nolan TJ, Massey HC Jr., Pearce EJ, Lok JB.
  TITLE     Transposon-mediated Chromosomal Integration of Transgenes in the 
            Parasitic Nematode Strongyloides ratti and Establishment of Stable 
            Transgenic Lines
  JOURNAL   PLoS Pathog. 8 (8), E1002871 (2012)
  PUBMED    22912584
REFERENCE   2  (bases 1 to 6758)
  AUTHORS   Shao H, Li X, Nolan TJ, Massey HC Jr., Pearce EJ, Lok JB.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2012) Pathobiology, University of Pennsylvania, 
            3800 Spruce Street, Philadelphia, PA 19104, USA
REFERENCE   3  (bases 1 to 6758)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6758)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS 
            Pathog."; date: "2012"; volume: "8"; issue: "8"; pages: "E1002871"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (03-MAY-2012) Pathobiology, University of Pennsylvania, 3800 Spruce 
            Street, Philadelphia, PA 19104, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6758
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        24..128
                     /label=AmpR promoter
     CDS             129..986
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      1160..1748
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    2036..2057
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2072..2102
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2110..2126
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2134..2150
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     mobile_element  2641..2675
                     /mobile_element_type="transposon:piggyBac ITR"
                     /label=ITR
     CDS             complement(3315..3326)
                     /label=Factor Xa site
                     /note="Factor Xa recognition and cleavage site"
     misc_recomb     3826..3830
                     /gene="act2"
                     /label=target sequence
                     /note="target sequence"
     CDS             join(4249..4419,4471..4624,4676..4839,4891..5118)
                     /codon_start=1
                     /product="GFP"
                     /label=GFP
                     /protein_id="AFN89784.1"
                     /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTFCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
                     NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITHGMDELYK"
     3'UTR           5138..5724
                     /gene="era1"
     gene            5138..5724
                     /gene="era1"
                     /label=era1
                     /note="Ss-era1"
     primer_bind     5738..5754
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     mobile_element  5951..6013
                     /mobile_element_type="transposon:piggyBac ITR"
                     /label=ITR
     misc_recomb     6014..6017
                     /label=target sequence
                     /note="target sequence"
     primer_bind     complement(6143..6159)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      6301..6756
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"