Basic Vector Information
- Vector Name:
- pPpGUT1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7107 bp
- Type:
- E.coli-K.pastoris shuttle vector
- Replication origin:
- ori
- Source/Author:
- Naatsaari L, Mistlberger B, Ruth C, Hajek T, Hartner FS, Glieder A.
- Promoter:
- AOX1
pPpGUT1 vector Map
pPpGUT1 vector Sequence
LOCUS 40924_35409 7107 bp DNA circular SYN 18-DEC-2018 DEFINITION E.coli-K.pastoris shuttle vector pPpGUT1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7107) AUTHORS Naatsaari L, Mistlberger B, Ruth C, Hajek T, Hartner FS, Glieder A. TITLE Deletion of the Pichia pastoris KU70 Homologue Facilitates Platform Strain Generation for Gene Expression and Synthetic Biology JOURNAL PLoS ONE 7 (6), E39720 (2012) PUBMED 22768112 REFERENCE 2 (bases 1 to 7107) AUTHORS Naeaetsaari L, Mistlberger B, Ruth C, Hajek T, Hartner F, Glieder A. TITLE Direct Submission JOURNAL Submitted (30-JAN-2012) Institute of Molecular Biotechnology, Graz University of Technology, Petersgasse 14/2, Graz, Styria 8010, Austria REFERENCE 3 (bases 1 to 7107) TITLE Direct Submission REFERENCE 4 (bases 1 to 7107) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "6"; pages: "E39720" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JAN-2012) Institute of Molecular Biotechnology, Graz University of Technology, Petersgasse 14/2, Graz, Styria 8010, Austria" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: SeqMan v. 7.0.0 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7107 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..900 /label=GUT1 promoter /note="GUT1 promoter" /regulatory_class="promoter" CDS 901..2766 /codon_start=1 /product="glycerol kinase" /label=glycerol kinase /note="GUT1" /protein_id="AFJ20664.1" /translation="MGKDYTPLVATIDIGTTSTRAILFDYHGQEVAKHQIEYSTSAQDD IKRKRSQIISSEGISLTVSDDLEVESVDNKAGPTLQFPQPGWVECRPSHILANAVQCLA ACLVTMENKNLDRDEKNKYKLISIGVANMRETTVVWSKKTGKPLYNGIVWNDTRNNDIV DEYTAKYSEKEREEMRTLCGCPISTYFSATKFRWLLKHVPEVKQAYDNADGDLMFGTID SWLIYHLTNEKSHVTDVTNASRTNFMNIETNKYDDRLLKFWDVDTSKVILPEIRSSAEV YGHFKVPHLESIGYVESYLTDDALALLETIEGAPLAGCLGDQSASLVGQLAVRKGDAKC TYGTGAFLLYNTGDQTLISEHGALTTVGYWFPGLDESEDGKHSSKPQYALEGSIAVAGS VVQWLRDNLRLISKAQDVGPLASQVDNSGGVVFVPAFSGLFAPYWDSNSRGTIFGLTQY TSASHIARAALEGVCFQTRAILKAMISDAGASADFLEESSKATGHNPLSVLAVDGGMSK SDEMMQIQADILGPCVTVRRSINPECTALGAAIAAGFGVPKEDRIWGSLKECTEAILEG NKMYLAAGNTSLDFKATLSDEVRRKEWRLWENAIAKAKGWLKDTA" regulatory 2767..3266 /label=GUT1 terminator /note="GUT1 terminator" /regulatory_class="terminator" promoter 3273..4204 /label=AOX1 promoter /note="inducible promoter, regulated by methanol" terminator 4232..4478 /label=AOX1 terminator /note="transcription terminator for AOX1" misc_feature 4492..5184 /note="integration sequence for recombination into target locus" regulatory 5185..5242 /label=EM72 synthetic promoter /note="EM72 synthetic promoter" /regulatory_class="promoter" CDS 5243..6100 /label=AmpR /note="beta-lactamase" terminator 6110..6297 /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" rep_origin 6461..7049 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.