Basic Vector Information
- Vector Name:
- pPPG2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10157 bp
- Type:
- Expression vector
- Replication origin:
- p15A ori
- Source/Author:
- Kang MK, Eom JH, Kim Y, Um Y, Woo HM.
- Promoter:
- tac
pPPG2 vector Vector Map
pPPG2 vector Sequence
LOCUS V003942 10157 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003942 VERSION V003942 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10157) AUTHORS Kang MK, Eom JH, Kim Y, Um Y, Woo HM. TITLE Biosynthesis of pinene from glucose using metabolically-engineered Corynebacterium glutamicum JOURNAL Biotechnol. Lett. (2014) In press PUBMED 24930112 REFERENCE 2 (bases 1 to 10157) AUTHORS Woo HM. TITLE Direct Submission JOURNAL Submitted (13-MAY-2014) Clean Energy Research Center, Korea Institute of Science and Technology, Hwarangno 14-gil 5, Seongbuk-gu, Seoul 136-791, Korea REFERENCE 3 (bases 1 to 10157) TITLE Direct Submission REFERENCE 4 (bases 1 to 10157) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Lett. (2014) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAY-2014) Clean Energy Research Center, Korea Institute of Science and Technology, Hwarangno 14-gil 5, Seongbuk-gu, Seoul 136-791, Korea" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10157 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 266..294 /label="tac promoter" /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 302..318 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 370..2256 /gene="PT1" /label="(-)-alpha-pinene synthase, chloroplastic" /note="(-)-alpha-pinene synthase, chloroplastic from Pinus taeda. Accession#: Q84KL6" RBS 2266..2277 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 2284..3429 /codon_start=1 /product="geranyl diphosphate synthase" /label="geranyl diphosphate synthase" /note="AgGPPS2; codon-optimized for C. glutamicum" /protein_id="AIF29191.1" /translation="MAYSAMATMGYNGMAASCHTLHPTSPLKPFHGASTSLEAFNGEHM GLLRGYSKRKLSSYKNPASRSSNATVAQLLNPPQKGKKAVEFDFNKYMDSKAMTVNEAL NKAIPLRYPQKIYESMRYSLLAGGKRVRPVLCIAACELVGGTEELAIPTACAIEMIHTM SLMHDDLPCIDNDDLRRGKPTNHKIFGEDTAVTAGNALHSYAFEHIAVSTSKTVGADRI LRMVSELGRATGSEGVMGGQMVDIASEGDPSIDLQTLEWIHIHKTAMLLECSVVCGAII GGASEIVIERARRYARCVGLLFQVVDDILDVTKSSDELGKTAGKDLISDKATYPKLMGL EKAKEFSDELLNRAKGELSCFDPVKAAPLLGLADYVAFRQN" terminator 3656..3742 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3834..3861 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" promoter 3880..3971 /label="AmpR promoter" CDS complement(7919..8731) /label="KanR" /note="aminoglycoside phosphotransferase" rep_origin complement(9326..9871) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin."
This page is informational only.