Basic Vector Information
- Vector Name:
- pPOP6IPT
- Antibiotic Resistance:
- Kanamycin
- Length:
- 11891 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Schafer M, Brutting C, Gase K, Reichelt M, Baldwin I, Meldau S.
- Promoter:
- NOS
pPOP6IPT vector Vector Map
pPOP6IPT vector Sequence
LOCUS 40924_35344 11891 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPOP6IPT, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11891) AUTHORS Schafer M, Brutting C, Gase K, Reichelt M, Baldwin I, Meldau S. TITLE 'Real time' genetic manipulation: a new tool for ecological field studies JOURNAL Plant J. 76 (3), 506-518 (2013) PUBMED 23906159 REFERENCE 2 (bases 1 to 11891) AUTHORS Gase K, Meldau S, Schaefer M, Baldwin IT. TITLE Direct Submission JOURNAL Submitted (18-JUN-2012) Molecular Ecology, Max-Planck-Institute for Chemical Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745, Germany REFERENCE 3 (bases 1 to 11891) TITLE Direct Submission REFERENCE 4 (bases 1 to 11891) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J."; date: "2013"; volume: "76"; issue: "3"; pages: "506-518" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-JUN-2012) Molecular Ecology, Max-Planck-Institute for Chemical Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11891 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory complement(1..345) /note="Agrobacterium tumefaciens isopentenyl phosphotransferase" /regulatory_class="terminator" CDS complement(420..1442) /label=HygR /note="aminoglycoside phosphotransferase from E. coli" promoter complement(1494..1673) /label=NOS promoter /note="nopaline synthase promoter" primer_bind complement(2094..2110) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 2118..2134 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2142..2172) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2187..2208) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2496..3084) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3371..4162) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory complement(4266..4271) /label=Transposon Tn5 /note="Transposon Tn5" /regulatory_class="minus_10_signal" regulatory complement(4289..4294) /label=Transposon Tn5 /note="Transposon Tn5" /regulatory_class="minus_35_signal" primer_bind 4667..4683 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 4729..4748 /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." protein_bind 4781..4800 /label=lac operator (symmetric) /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." protein_bind 4833..4852 /label=lac operator (symmetric) /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." protein_bind 4885..4904 /label=lac operator (symmetric) /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." protein_bind 4937..4956 /label=lac operator (symmetric) /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." protein_bind complement(4989..5008) /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." promoter 5032..5078 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" CDS 5111..5833 /codon_start=1 /product="IPT" /label=IPT /note="Agrobacterium tumefaciens isopentenyl transferase" /protein_id="AGI38108.1" /translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP QVNAAAFDGFEGHPFGMY" regulatory 5899..6058 /label=cauliflower mosaic virus /note="cauliflower mosaic virus" /regulatory_class="terminator" misc_feature 6125..6149 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(7303..7497) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(7566..8636) /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(9068..9694) /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 11178..11202 /label=LB T-DNA repeat /note="left border repeat from octopine Ach5 T-DNA"
This page is informational only.