Basic Vector Information
- Vector Name:
- pPOP6IPT
- Antibiotic Resistance:
- Kanamycin
- Length:
- 11891 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Schafer M, Brutting C, Gase K, Reichelt M, Baldwin I, Meldau S.
- Promoter:
- NOS
pPOP6IPT vector Vector Map
pPOP6IPT vector Sequence
LOCUS 40924_35344 11891 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPOP6IPT, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 11891)
AUTHORS Schafer M, Brutting C, Gase K, Reichelt M, Baldwin I, Meldau S.
TITLE 'Real time' genetic manipulation: a new tool for ecological field
studies
JOURNAL Plant J. 76 (3), 506-518 (2013)
PUBMED 23906159
REFERENCE 2 (bases 1 to 11891)
AUTHORS Gase K, Meldau S, Schaefer M, Baldwin IT.
TITLE Direct Submission
JOURNAL Submitted (18-JUN-2012) Molecular Ecology, Max-Planck-Institute for
Chemical Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745,
Germany
REFERENCE 3 (bases 1 to 11891)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 11891)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J.";
date: "2013"; volume: "76"; issue: "3"; pages: "506-518"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(18-JUN-2012) Molecular Ecology, Max-Planck-Institute for Chemical
Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..11891
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory complement(1..345)
/note="Agrobacterium tumefaciens isopentenyl
phosphotransferase"
/regulatory_class="terminator"
CDS complement(420..1442)
/label=HygR
/note="aminoglycoside phosphotransferase from E. coli"
promoter complement(1494..1673)
/label=NOS promoter
/note="nopaline synthase promoter"
primer_bind complement(2094..2110)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 2118..2134
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2142..2172)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(2187..2208)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(2496..3084)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3371..4162)
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
regulatory complement(4266..4271)
/label=Transposon Tn5
/note="Transposon Tn5"
/regulatory_class="minus_10_signal"
regulatory complement(4289..4294)
/label=Transposon Tn5
/note="Transposon Tn5"
/regulatory_class="minus_35_signal"
primer_bind 4667..4683
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 4729..4748
/label=lac operator (symmetric)
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
protein_bind 4781..4800
/label=lac operator (symmetric)
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
protein_bind 4833..4852
/label=lac operator (symmetric)
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
protein_bind 4885..4904
/label=lac operator (symmetric)
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
protein_bind 4937..4956
/label=lac operator (symmetric)
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
protein_bind complement(4989..5008)
/label=lac operator (symmetric)
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
promoter 5032..5078
/label=minimal CaMV 35S promoter
/note="minimal 35S promoter from cauliflower mosaic virus"
CDS 5111..5833
/codon_start=1
/product="IPT"
/label=IPT
/note="Agrobacterium tumefaciens isopentenyl transferase"
/protein_id="AGI38108.1"
/translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS
GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN
CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR
LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP
QVNAAAFDGFEGHPFGMY"
regulatory 5899..6058
/label=cauliflower mosaic virus
/note="cauliflower mosaic virus"
/regulatory_class="terminator"
misc_feature 6125..6149
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
rep_origin complement(7303..7497)
/direction=LEFT
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(7566..8636)
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(9068..9694)
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
misc_feature 11178..11202
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
This page is informational only.