Basic Vector Information
- Vector Name:
- pPLV13
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6538 bp
- Type:
- Cloning vector
- Replication origin:
- pSa ori
- Source/Author:
- De Rybel B, van den Berg W, Lokerse A, Liao CY, van Mourik H, Moller B, Peris CL, Weijers D.
- Promoter:
- T7
pPLV13 vector Map
pPLV13 vector Sequence
LOCUS 40924_35164 6538 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPLV13, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6538) AUTHORS De Rybel B, van den Berg W, Lokerse A, Liao CY, van Mourik H, Moller B, Peris CL, Weijers D. TITLE A versatile set of ligation-independent cloning vectors for functional studies in plants JOURNAL Plant Physiol. 156 (3), 1292-1299 (2011) PUBMED 21562332 REFERENCE 2 (bases 1 to 6538) AUTHORS De Rybel B, van den Berg W, Weijers D. TITLE Direct Submission JOURNAL Submitted (04-MAY-2011) Laboratory of Biochemistry, Wageningen University, Dreijenlaan 3, Wageningen 6703HA, The Netherlands REFERENCE 3 (bases 1 to 6538) TITLE Direct Submission REFERENCE 4 (bases 1 to 6538) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Physiol."; date: "2011"; volume: "156"; issue: "3"; pages: "1292-1299" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-MAY-2011) Laboratory of Biochemistry, Wageningen University, Dreijenlaan 3, Wageningen 6703HA, The Netherlands" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6538 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(66..654) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(828..1640) /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 1931..2366 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 2501..2523 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" terminator complement(2534..2786) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(2823..3371) /label=BlpR /note="phosphinothricin acetyltransferase" promoter complement(3413..3592) /label=NOS promoter /note="nopaline synthase promoter" primer_bind 3819..3835 /note="M13F; M13 forward primer site" primer_bind 3839..3855 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3865..3883 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 3909..3925 /label=KS primer /note="common sequencing primer, one of multiple similar variants" misc_feature 3946..3975 /note="LIC; ligation-independent cloning (LIC) site" CDS 3983..5797 /codon_start=1 /product="beta-glucuronidase" /label=beta-glucuronidase /note="GUS" /protein_id="AEG42766.1" /translation="MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI AVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEV MEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHD FFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQ VVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGQQF LINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDW ADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARD KNHPSVVMWSIANEPDTRPQVHGNISPLAEATRKLDPTRPITCVNVMFCDAHTDTISDL FDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYT DMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKP KSAAFLLQKRWTGMNFGEKPQQGGKQTS" terminator 5811..6059 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" promoter complement(6096..6114) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(6135..6151) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(6159..6175) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6183..6214) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(6229..6250) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." misc_feature 6489..6513 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.