Basic Vector Information
- Vector Name:
- pPLV04_v2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6753 bp
- Type:
- Cloning vector
- Replication origin:
- pSa ori
- Source/Author:
- Wendrich JR, Liao CY, van den Berg WA, De Rybel B, Weijers D.
pPLV04_v2 vector Map
pPLV04_v2 vector Sequence
LOCUS 40924_35099 6753 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPLV04_v2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6753) AUTHORS Wendrich JR, Liao CY, van den Berg WA, De Rybel B, Weijers D. TITLE Ligation-independent cloning for plant research JOURNAL Methods Mol. Biol. 1284, 421-431 (2015) PUBMED 25757785 REFERENCE 2 (bases 1 to 6753) AUTHORS Wendrich JR, Liao C-Y., van den Berg WAM., De Rybel B, Weijers D. TITLE Direct Submission JOURNAL Submitted (25-JUN-2014) Laboratory of Biochemistry, Wageningen University, Dreijenlaan 3, Wageningen 6703HA, The Netherlands REFERENCE 3 (bases 1 to 6753) TITLE Direct Submission REFERENCE 4 (bases 1 to 6753) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Methods Mol. Biol. 1284, 421-431 (2015)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-JUN-2014) Laboratory of Biochemistry, Wageningen University, Dreijenlaan 3, Wageningen 6703HA, The Netherlands" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6753 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(66..654) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(828..1640) /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 1931..2366 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 2493..2515 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" terminator complement(2539..2791) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(2834..3625) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" promoter complement(3659..3838) /label=NOS promoter /note="nopaline synthase promoter" primer_bind 4085..4101 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 4111..4129 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 4155..4171 /label=KS primer /note="common sequencing primer, one of multiple similar variants" misc_feature 4192..4221 /note="LIC; ligation-independent cloning (LIC) site" CDS 4234..4254 /codon_start=1 /product="nuclear localization signal of SV40 (simian virus 40) large T antigen" /label=SV40 NLS /translation="PKKKRKV" CDS 4255..4971 /label=EGFP /note="enhanced GFP" CDS 4978..5694 /codon_start=1 /product="enhanced GFP" /label=EGFP /note="mammalian codon-optimized" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 5701..6420 /codon_start=1 /product="enhanced GFP" /label=EGFP /note="mammalian codon-optimized" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" terminator 6434..6682 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature 6704..6728 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.