pPLEX-5031 vector (V004014)

LOCUS       40924_35039       14033 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPLEX-5031, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14033)
  AUTHORS   Schunmann PHD., Surin B, Waterhouse PM.
  TITLE     A suite of novel promoters and terminators for plant biotechnology. 
            II. The pPLEX series for use in monocots
  JOURNAL   Funct. Plant Biol. 30, 453-460 (2003)
REFERENCE   2  (bases 1 to 14033)
  AUTHORS   Schunmann PHD.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-2003) CSIRO Plant Industry, GPO Box 1600, 
            Canberra, ACT 2617, Australia
REFERENCE   3  (bases 1 to 14033)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 14033)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Funct. 
            Plant Biol. 30, 453-460 (2003)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-JAN-2003) CSIRO Plant Industry, GPO Box 1600, Canberra, ACT 
            2617, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..14033
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      21..565
                     /note="S4 promoter derived from subterranean clover stunt
                     virus DNA segment 4"
                     /regulatory_class="promoter"
     intron          609..1618
                     /number=1
                     /note="ubiquitin; Ubi1"
     misc_feature    1639..1680
                     /note="multiple cloning site; MCS"
     regulatory      1681..2574
                     /note="Me1 terminator derived from Flavaria bidentis NADP
                     malic gene"
                     /regulatory_class="terminator"
     promoter        2723..3067
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     intron          3416..3605
                     /label=cat1 intron
                     /note="castor bean catalase intron, modified"
     terminator      4333..4585
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     promoter        complement(4655..4838)
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     misc_feature    4994..5018
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      5499..6212
                     /label=oriV
                     /note="incP origin of replication"
     CDS             complement(6817..7605)
                     /codon_start=1
                     /product="spectinomycin resistant protein"
                     /label=spectinomycin resistant protein
                     /protein_id="AAP23189.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      8702..9290
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(10653..11798)
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             complement(12073..12423)
                     /label=traJ
                     /note="oriT-recognizing protein"
     mobile_element  complement(12423..13190)
                     /label=IS1
                     /note="prokaryotic transposable element"
     oriT            complement(13250..13359)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     misc_feature    13914..13938
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"