Basic Vector Information
- Vector Name:
- pPLEX-3004
- Length:
- 13070 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, Waterhouse PM.
pPLEX-3004 vector Map
pPLEX-3004 vector Sequence
LOCUS 40924_34974 13070 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPLEX-3004, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 13070)
AUTHORS Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC,
Waterhouse PM.
TITLE A suite of novel promoters and terminators for plant biotechnology
JOURNAL Funct. Plant Biol. 30, 443-452 (2003)
REFERENCE 2 (bases 1 to 13070)
AUTHORS Schunmann PHD.
TITLE Direct Submission
JOURNAL Submitted (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street,
Canberra, ACT 2602, Australia
REFERENCE 3 (bases 1 to 13070)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 13070)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Funct.
Plant Biol. 30, 443-452 (2003)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra,
ACT 2602, Australia"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..13070
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 23..1068
/note="S7S7 promoter derived from subterranean clover stunt
virus DNA segment 7"
/regulatory_class="promoter"
misc_feature 1069..1116
/note="multiple cloning site; MCS"
regulatory 1117..2010
/note="Me1 terminator derived from Flavaria bidentis NADP
malic enzyme gene"
/regulatory_class="terminator"
misc_feature 2186..2210
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
rep_origin 2690..3403
/label=oriV
/note="incP origin of replication"
CDS complement(4008..4796)
/codon_start=1
/product="spectinomycin resistant protein"
/label=spectinomycin resistant protein
/protein_id="AAP22315.1"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
rep_origin 5893..6481
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(7844..8989)
/label=trfA
/note="trans-acting replication protein that binds to and
activates oriV"
CDS complement(9264..9614)
/label=traJ
/note="oriT-recognizing protein"
mobile_element complement(9614..10381)
/label=IS1
/note="prokaryotic transposable element"
oriT complement(10441..10550)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
misc_feature 11105..11129
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
regulatory 11213..11735
/note="S1 promoter derived from subterranean clover stunt
virus DNA segment 1"
/regulatory_class="promoter"
intron 11928..12117
/label=cat1 intron
/note="castor bean catalase intron, modified"
regulatory 12911..13049
/note="S3 terminator derived from subterranean clover stunt
virus DNA segment 3"
/regulatory_class="terminator"
This page is informational only.