pPLEX-3003 vector (V004028)

Basic Vector Information

Vector Name:
pPLEX-3003
Length:
12578 bp
Type:
Cloning vector
Replication origin:
oriV
Source/Author:
Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, Waterhouse PM.

pPLEX-3003 vector Map

pPLEX-300312578 bp60012001800240030003600420048005400600066007200780084009000960010200108001140012000S7 promoter derived from subterranean clover stunt virus DNA segment 7multiple cloning site; MCSMe1 terminator derived from Flavaria bidentis NADP malic enzyme geneRB T-DNA repeatoriVspectinomycin resistant proteinoritrfAIS1oriTLB T-DNA repeatS1 promoter derived from subterranean clover stunt virus DNA segment 1cat1 intronS3 terminator derived from subterranean clover stunt virus DNA segment 3

pPLEX-3003 vector Sequence

LOCUS       40924_34969       12578 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPLEX-3003, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12578)
  AUTHORS   Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, 
            Waterhouse PM.
  TITLE     A suite of novel promoters and terminators for plant biotechnology
  JOURNAL   Funct. Plant Biol. 30, 443-452 (2003)
REFERENCE   2  (bases 1 to 12578)
  AUTHORS   Schunmann PHD.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, 
            Canberra, ACT 2602, Australia
REFERENCE   3  (bases 1 to 12578)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12578)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Funct. 
            Plant Biol. 30, 443-452 (2003)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra, 
            ACT 2602, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12578
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      23..576
                     /note="S7 promoter derived from subterranean clover stunt
                     virus DNA segment 7"
                     /regulatory_class="promoter"
     misc_feature    577..624
                     /note="multiple cloning site; MCS"
     regulatory      625..1518
                     /note="Me1 terminator derived from Flavaria bidentis NADP
                     malic enzyme gene"
                     /regulatory_class="terminator"
     misc_feature    1694..1718
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      2198..2911
                     /label=oriV
                     /note="incP origin of replication"
     CDS             complement(3516..4304)
                     /codon_start=1
                     /product="spectinomycin resistant protein"
                     /label=spectinomycin resistant protein
                     /protein_id="AAP22313.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      5401..5989
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7352..8497)
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             complement(8772..9122)
                     /label=traJ
                     /note="oriT-recognizing protein"
     mobile_element  complement(9122..9889)
                     /label=IS1
                     /note="prokaryotic transposable element"
     oriT            complement(9949..10058)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     misc_feature    10613..10637
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     regulatory      10721..11243
                     /note="S1 promoter derived from subterranean clover stunt
                     virus DNA segment 1"
                     /regulatory_class="promoter"
     intron          11436..11625
                     /label=cat1 intron
                     /note="castor bean catalase intron, modified"
     regulatory      12419..12557
                     /note="S3 terminator derived from subterranean clover stunt
                     virus DNA segment 3"
                     /regulatory_class="terminator"

This page is informational only.