pPLEX-3002 vector (V004029)

LOCUS       40924_34964       13015 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPLEX-3002, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13015)
  AUTHORS   Schunmann PHD., Llewellyn DJ, Surin B, Boevink P, De Feyter RC, 
            Waterhouse PM.
  TITLE     A suite of novel promoters and terminators for plant biotechnology
  JOURNAL   Funct. Plant Biol. 30, 443-452 (2003)
REFERENCE   2  (bases 1 to 13015)
  AUTHORS   Schunmann PHD.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, 
            Canberra, ACT 2602, Australia
REFERENCE   3  (bases 1 to 13015)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 13015)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Funct. 
            Plant Biol. 30, 443-452 (2003)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (01-OCT-2002) Plant Industry, CSIRO, Clunies Ross Street, Canberra, 
            ACT 2602, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13015
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      21..1013
                     /note="S4S4 promoter derived from subterranean clover stunt
                     virus DNA segment 4"
                     /regulatory_class="promoter"
     misc_feature    1014..1061
                     /note="multiple cloning site; MCS"
     regulatory      1062..1955
                     /note="Me1 terminator derived from Flavaria bidentis NADP
                     malic enzyme gene"
                     /regulatory_class="terminator"
     misc_feature    2131..2155
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      2635..3348
                     /label=oriV
                     /note="incP origin of replication"
     CDS             complement(3953..4741)
                     /codon_start=1
                     /product="spectinomycin resistant protein"
                     /label=spectinomycin resistant protein
                     /protein_id="AAP22311.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      5838..6426
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7789..8934)
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             complement(9209..9559)
                     /label=traJ
                     /note="oriT-recognizing protein"
     mobile_element  complement(9559..10326)
                     /label=IS1
                     /note="prokaryotic transposable element"
     oriT            complement(10386..10495)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     misc_feature    11050..11074
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     regulatory      11158..11680
                     /note="S1 promoter derived from subterranean clover stunt
                     virus DNA segment 1"
                     /regulatory_class="promoter"
     intron          11873..12062
                     /label=cat1 intron
                     /note="castor bean catalase intron, modified"
     regulatory      12856..12994
                     /note="S3 terminator derived from subterranean clover stunt
                     virus DNA segment 3"
                     /regulatory_class="terminator"