Basic Vector Information
- Vector Name:
- pPLaACR26
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6783 bp
- Type:
- Bacterial expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pPLaACR26 vector Vector Map
pPLaACR26 vector Sequence
LOCUS V004039 6783 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004039 VERSION V004039 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6783) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6783) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6783) TITLE Direct Submission REFERENCE 4 (bases 1 to 6783) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6783 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory complement(117..247) /label="PL promoter" /note="PL promoter" /regulatory_class="promoter" CDS 615..1427 /label="KanR" /note="aminoglycoside phosphotransferase" rep_origin complement(1889..2477) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2965..3154) /label="insertion element 1" /note="insertion element 1" CDS complement(3491..5128) /codon_start=1 /note="unnamed protein product; POL" /protein_id="SJL88457.1" /translation="MSKTTKKFNSLCIDLPRDLSLEIYQSIASVATGSGDPHSDDFTAI AYLRDELLTKHPTLGSGNDEATRRTLAIAKLREANGDRGQINREGFLHDKSLSWDPDVL QTSIRSLIGNLLSGYRSSLFGQCTFSNGAPMGHKLQDAAPYKKFAEQATVTPRALRAAL LVRDQCAPWIRHAVRYNESYEFRLVVGNGVFTVPKNNKIDRAACKEPDMNMYLQKGVGA FIRRRLKSVGIDLNDQSINQRLAQQGSVDGSLATIDLSSASDSISDRLVWSFLPPELYS YLDRIRSHYGIVDGETIRWELFSTMGNGFTFELESMIFWAIVKATQIHFGNAGTIGIYG DDIICPSEIAPRVLEALAYYGFKPNLRKTFVSGLFRESCGAHFYRGVDVKPFYIKKPVD NLFALMLILNRLRGWGVVGGMSDPRLYKVWVRLSSQVPSMFFGGTDLAADYYVVSPPTA VSVYTKTPYGRLLADTRTSGFRLARIARERKFFSEKHDSGRYIAWFHTGGEITDSMKSA GVRVIRTSEWLTPVPTFPQECGPASSPR" misc_feature complement(5129..5161) /label="5' UTR of POL" /note="5' UTR of POL" CDS complement(5165..5551) /label="MS2" /note="bacteriophage MS2 coat protein" misc_feature complement(5555..5577) /label="5' UTR of COAT" /note="5' UTR of COAT" CDS complement(5581..6759) /gene="A" /label="Maturation protein A" /note="Maturation protein A from Escherichia phage MS2. Accession#: P03610" misc_feature complement(6760..6783) /label="5' UTR of A" /note="5' UTR of A"
This page is informational only.