pPIPRA726 vector (V004083)

LOCUS       40924_34714       10181 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPIPRA726, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10181)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, 
            Johnson D, Reich J, Bennett AB.
  TITLE     Constitutive expression of eIF5A3 increases high quality biomass 
            yield in an elite alfalfa cultivar
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10181)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, 
            Johnson D, Reich J, Bennett AB.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields 
            Avenue, Davis, CA 95616, USA
REFERENCE   3  (bases 1 to 10181)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10181)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, 
            CA 95616, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10181
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    245..269
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     promoter        362..742
                     /label=MAS promoter
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     CDS             762..1550
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     terminator      1571..1823
                     /label=MAS terminator
                     /note="mannopine synthase terminator"
     regulatory      1874..2455
                     /label=histone H3
                     /note="histone H3"
                     /regulatory_class="promoter"
     CDS             2497..2976
                     /codon_start=1
                     /gene="eIF5A3"
                     /product="eukaryotic translation initiation factor 5A"
                     /label=eIF5A3
                     /note="eIF5A3; derived from Populus deltoides"
                     /protein_id="AKE42828.1"
                     /translation="MSDEEQHFESKADAGASKTYPQQAGTIRKSGYIVIKNRPCKVVEV
                     STSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSL
                     LTENGNTKDDLRLPTDESLLSQIKDGFGEGKDLVVTVMSSMGEEQICALKDVGPK"
     gene            2497..2976
                     /gene="eIF5A3"
                     /label=eIF5A3
                     /note="PdeIF5A3"
     regulatory      2999..3302
                     /label=pea E9
                     /note="pea E9"
                     /regulatory_class="terminator"
     misc_feature    3389..3413
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             4865..5491
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             5923..6993
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      7062..7256
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    7730..7870
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8056..8644)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9112..9903)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"