Basic Vector Information
- Vector Name:
- pPIPRA719
- Antibiotic Resistance:
- Kanamycin
- Length:
- 13015 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB.
- Promoter:
- MAS
pPIPRA719 vector Vector Map
pPIPRA719 vector Sequence
LOCUS 40924_34704 13015 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPIPRA719, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 13015) AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB. TITLE Constitutive expression of eIF5A3 increases high quality biomass yield in an elite alfalfa cultivar JOURNAL Unpublished REFERENCE 2 (bases 1 to 13015) AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB. TITLE Direct Submission JOURNAL Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, CA 95616, USA REFERENCE 3 (bases 1 to 13015) TITLE Direct Submission REFERENCE 4 (bases 1 to 13015) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, CA 95616, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..13015 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 26..406 /label=MAS promoter /note="mannopine synthase promoter (Velten et al., 1984)" CDS 420..1142 /codon_start=1 /gene="ipt" /product="isopentenyl phosphotransferase" /label=ipt /note="involved in condensation of AMP and isopentenylpyrophosphate to form isopentenyl-AMP" /protein_id="AKE42814.1" /translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP QVNAAAFDGFEGHPFGMY" gene 420..1142 /gene="ipt" /label=ipt terminator 1505..1757 /label=MAS terminator /note="mannopine synthase terminator" misc_feature 1782..1949 /label=T-DNA left border /note="T-DNA left border" regulatory 1974..2372 /label=mas /note="mas" /regulatory_class="promoter" promoter 1984..2364 /label=MAS promoter /note="mannopine synthase promoter (Velten et al., 1984)" CDS 2384..3172 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory 3182..3458 /label=mas /note="mas" /regulatory_class="terminator" terminator 3193..3445 /label=MAS terminator /note="mannopine synthase terminator" regulatory 3502..4445 /label=FMV34S /note="FMV34S" /regulatory_class="promoter" CDS 4512..5792 /label=codA /note="E. coli cytosine deaminase" regulatory 5810..6110 /label=pea E9 /note="pea E9" /regulatory_class="terminator" misc_feature 6154..6362 /label=T-DNA left border /note="T-DNA left border" CDS 7699..8325 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 8757..9827 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 9896..10090 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 10564..10704 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(10890..11478) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(11946..12737) /label=KanR /note="aminoglycoside phosphotransferase"
This page is informational only.