Basic Vector Information
- Vector Name:
- pPIPRA713
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10675 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB.
- Promoter:
- MAS
pPIPRA713 vector Vector Map
pPIPRA713 vector Sequence
LOCUS 40924_34699 10675 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pPIPRA713, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10675) AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB. TITLE Constitutive expression of eIF5A3 increases high quality biomass yield in an elite alfalfa cultivar JOURNAL Unpublished REFERENCE 2 (bases 1 to 10675) AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB. TITLE Direct Submission JOURNAL Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, CA 95616, USA REFERENCE 3 (bases 1 to 10675) TITLE Direct Submission REFERENCE 4 (bases 1 to 10675) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, CA 95616, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10675 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 26..406 /label=MAS promoter /note="mannopine synthase promoter (Velten et al., 1984)" CDS 420..1142 /codon_start=1 /gene="ipt" /product="isopentenyl phosphotransferase" /label=ipt /note="involved in condensation of AMP and isopentenylpyrophosphate to form isopentenyl-AMP" /protein_id="AKE42821.1" /translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP QVNAAAFDGFEGHPFGMY" gene 420..1142 /gene="ipt" /label=ipt terminator 1505..1757 /label=MAS terminator /note="mannopine synthase terminator" misc_feature 1782..1949 /label=T-DNA left border /note="T-DNA left border" regulatory 1981..2924 /label=FMV34S /note="FMV34S" /regulatory_class="promoter" CDS 2976..3455 /codon_start=1 /gene="eIF5A3" /product="eukaryotic translation initiation factor 5A" /label=eIF5A3 /note="eIF5A3; derived from Populus deltoides" /protein_id="AKE42822.1" /translation="MSDEEQHFESKADAGASKTYPQQAGTIRKSGYIVIKNRPCKVVEV STSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSL LTENGNTKDDLRLPTDESLLSQIKDGFGEGKDLVVTVMSSMGEEQICALKDVGPK" gene 2976..3455 /gene="eIF5A3" /label=eIF5A3 /note="PdeIF5A3" regulatory 3478..3781 /label=pea E9 /note="pea E9" /regulatory_class="terminator" misc_feature 3812..4020 /label=T-DNA left border /note="T-DNA left border" CDS 5359..5985 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 6417..7487 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 7556..7750 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 8224..8364 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(8550..9138) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9606..10397) /label=KanR /note="aminoglycoside phosphotransferase"
This page is informational only.